BioLiP

>protein
AHMNDIKQLLWNGELNVLVSIDPSFLMKGSEIAVLRIRVPRETYLVNYMPLIWNKISEKYFWFEHNKTPIPWNYPVGVLF
DCLASFENQVKDVLTFLRIHLVMGDSLPPTIIPIASSKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNEARKFWGSVIT
RNFQDFIEISNKISSSRPRHIPLIIQTSRFRISQPTISMTGVNPTLKDIEGDIDVMVICQGIEIPWHMLLYDLYSKLRSF
DGFLYITLVPI

The query sequence (length=251) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2dym:G	262	266	0.9801	0.9389	0.9248	1.19e-172	2dym:A, 2dym:E, 2dym:C, 3w1s:A
2	7w36:A	262	235	0.2311	0.2214	0.2468	1.13e-08
3	1y8a:A	313	74	0.0797	0.0639	0.2703	1.0
4	6cbq:A	234	108	0.0996	0.1068	0.2315	1.4	6cbq:B, 6cc0:A, 6cc0:B, 3szt:A, 3szt:B
5	3h9d:B	116	38	0.0478	0.1034	0.3158	3.4
6	4zra:A	196	79	0.0797	0.1020	0.2532	3.6	3mha:A
7	7mq8:LT	869	52	0.0637	0.0184	0.3077	4.4	7mq9:LT
8	8ulg:A	827	44	0.0677	0.0206	0.3864	5.3	7jsn:A, 6mzb:A, 8ufi:A, 8ugb:A, 8ugs:A
9	4h8n:A	303	54	0.0598	0.0495	0.2778	5.6	4h8n:B
10	8foc:B	450	55	0.0717	0.0400	0.3273	5.7	6di2:A, 6di6:A, 6dtv:A, 6dtz:A, 6du0:A, 8fod:B, 8foh:B, 8foj:B, 8fok:B, 3lgb:A, 3lgb:B, 7tl2:A, 7tl3:A, 7tl4:A
11	5fhz:F	449	56	0.0598	0.0334	0.2679	8.7
12	6aaf:A	112	23	0.0438	0.0982	0.4783	9.2
13	7a6q:A	489	56	0.0598	0.0307	0.2679	9.6	7a6q:B, 5fhz:A, 5fhz:B, 5fhz:C, 5fhz:D, 5fhz:E, 5fhz:G, 5fhz:H, 7qk8:A, 7qk8:B, 7qk9:A, 7qk9:B, 6s6w:A, 6s6w:B, 6te5:A, 6te5:B, 6tgw:A, 6tgw:B, 6tgw:C, 6tgw:D, 6try:A, 6try:B

[Back]