BioLiP

>protein
AHMNDIKQLLWNGELNVLVSIDPSFLMKEIAVLRIRVPRETYLVNYMPLIWNKIKSFLEKYFWFEHNKTPIPWNYPVGVL
FDCLATFTTSFENQVKDVLTFLRIHLVMGDSLPPTIIPIASSKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNEARKFW
GSVITRNFQDFIEISNKISRPRHIPLIIQTSRTSGTFRISQPTISMTGVNPTLKDIEGDILDVKDVMVICQGIEIPWHML
LYDLYSKLRSFDGFLYITLVPI

The query sequence (length=262) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2dym:G	262	262	1.0000	1.0000	1.0000	0.0	2dym:A, 2dym:E, 2dym:C, 3w1s:A
2	7w36:A	262	238	0.2252	0.2252	0.2479	3.87e-10
3	6cbq:A	234	108	0.1107	0.1239	0.2685	0.18	6cbq:B, 6cc0:A, 6cc0:B, 3szt:A, 3szt:B
4	7jgr:A	401	82	0.0878	0.0574	0.2805	1.1	7jgs:A, 7jk2:A, 7jk3:A, 7jk4:A, 7jk5:A, 7jk6:A
5	6sp0:A	197	49	0.0496	0.0660	0.2653	3.0
6	7ebt:B	222	62	0.0649	0.0766	0.2742	3.2	7ebt:A, 7ebt:C, 7ebt:D, 7ebu:A, 7ebu:B, 7ebu:C, 7ebu:D, 7ebv:A, 7ebv:B, 7ebv:C, 7ebv:D, 7ebw:A, 7ebw:B, 7ebw:C, 7ebw:D
7	8q4h:A	503	34	0.0573	0.0298	0.4412	3.4	8q4h:B
8	8ulg:A	827	44	0.0649	0.0206	0.3864	6.1	7jsn:A, 6mzb:A, 8ufi:A, 8ugb:A, 8ugs:A
9	3h9d:B	116	23	0.0382	0.0862	0.4348	6.3
10	8foc:B	450	50	0.0649	0.0378	0.3400	6.4	6di2:A, 6di6:A, 6dtv:A, 6dtz:A, 6du0:A, 8fod:B, 8foh:B, 8foj:B, 8fok:B, 3lgb:A, 3lgb:B, 7tl2:A, 7tl3:A, 7tl4:A
11	8cbj:i	262	76	0.0802	0.0802	0.2763	7.4	7ajt:JH, 7d4i:RS, 7d5s:RS, 7d63:RS, 6eml:e, 6fai:i, 6ke6:RS, 6lqp:RS, 6lqq:RS, 6lqr:RS, 6lqs:RS, 6lqu:RS, 6lqv:RS, 6rbd:i, 7suk:SZ, 5wlc:SZ, 5wyj:E3, 6y7c:i, 6zqa:JH, 6zqb:JH, 6zqc:JH
12	8wce:A	994	52	0.0763	0.0201	0.3846	8.0
13	8wcs:A	1044	52	0.0763	0.0192	0.3846	8.3
14	4hr6:C	264	48	0.0496	0.0492	0.2708	9.2	5y97:C
15	6aaf:A	112	23	0.0420	0.0982	0.4783	9.5

[Back]