AHMNDIKQLLWNGELNVLVSIDPSFLMEIAVLRIRVPRETYLVNYMPLIWNKEKYFWFEHNKTPIPWNYPVGVLFDCLAS
FENQVKDVLTFLRIHLVMGDSLPPTIIPIASSKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNEARKFWGSVITRNFQD
FIEISNKISSSRPRHIPLIIQTSRTRISQPTISMTGVNPTLKDIEGDILDVMVICQGIEIPWHMLLYDLYSKLRSFDGFL
YITLVPI
The query sequence (length=247) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2dym:G | 262 | 264 | 0.9919 | 0.9351 | 0.9280 | 1.06e-171 | 2dym:A, 2dym:E, 2dym:C, 3w1s:A |
2 | 7w36:A | 262 | 234 | 0.2389 | 0.2252 | 0.2521 | 3.41e-08 | |
3 | 6cbq:A | 234 | 108 | 0.1053 | 0.1111 | 0.2407 | 0.23 | 6cbq:B, 6cc0:A, 6cc0:B, 3szt:A, 3szt:B |
4 | 1ffq:A | 540 | 45 | 0.0567 | 0.0259 | 0.3111 | 2.7 | 7fd6:A, 2wk2:A, 2wly:A, 2wlz:A, 2wm0:A, 1x6n:A |
5 | 7mq8:LT | 869 | 52 | 0.0648 | 0.0184 | 0.3077 | 5.0 | 7mq9:LT |
6 | 8foc:B | 450 | 55 | 0.0729 | 0.0400 | 0.3273 | 5.0 | 6di2:A, 6di6:A, 6dtv:A, 6dtz:A, 6du0:A, 8fod:B, 8foh:B, 8foj:B, 8fok:B, 3lgb:A, 3lgb:B, 7tl2:A, 7tl3:A, 7tl4:A |
7 | 8ulg:A | 827 | 44 | 0.0688 | 0.0206 | 0.3864 | 5.5 | 7jsn:A, 6mzb:A, 8ufi:A, 8ugb:A, 8ugs:A |
8 | 4h8n:A | 303 | 54 | 0.0607 | 0.0495 | 0.2778 | 5.6 | 4h8n:B |
9 | 3h9d:B | 116 | 23 | 0.0405 | 0.0862 | 0.4348 | 6.0 | |
10 | 6aaf:A | 112 | 23 | 0.0445 | 0.0982 | 0.4783 | 9.2 |