AHLRREYTKGGLRRRDLPADPLTLFERWLSQACEAKLADPTAMVVATVDEHGQPYQRIVLLKHYDEKGMVFYTNLGSRKA
HQIENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYSFWGGFRVSLEQIEFWQGGEHRLHDRFLYQRENDAWKIDRL
AP
The query sequence (length=162) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1wv4:A | 162 | 162 | 1.0000 | 1.0000 | 1.0000 | 1.81e-121 | 1wv4:B, 6ymh:AAA |
2 | 1jnw:A | 214 | 208 | 1.0000 | 0.7570 | 0.7788 | 1.01e-112 | 1dnl:A, 1g76:A, 1g77:A, 1g78:A, 1g79:A, 6ylz:AAA, 6ymh:BBB |
3 | 1ci0:A | 205 | 203 | 0.4074 | 0.3220 | 0.3251 | 1.17e-27 | 1ci0:B |
4 | 4hmt:B | 207 | 190 | 0.3210 | 0.2512 | 0.2737 | 5.78e-24 | 4hms:A, 4hms:B, 4hmt:A, 4hmu:A, 4hmu:B, 4hmv:A, 4hmv:B, 1ty9:A, 1ty9:B |
5 | 1nrg:A | 213 | 178 | 0.3395 | 0.2582 | 0.3090 | 9.22e-22 | 6h00:A, 3hy8:A, 8qyt:A, 8qyw:A |
6 | 1t9m:A | 204 | 189 | 0.3272 | 0.2598 | 0.2804 | 6.68e-21 | 1t9m:B |
7 | 4hmw:B | 205 | 191 | 0.3025 | 0.2390 | 0.2565 | 2.22e-19 | 4hmw:A, 4hmx:A, 4hmx:B |
8 | 2i02:A | 140 | 66 | 0.1173 | 0.1357 | 0.2879 | 0.34 | 2i02:B |
9 | 3jd5:I | 311 | 106 | 0.1667 | 0.0868 | 0.2547 | 0.61 | 6neq:I, 6nf8:I |
10 | 4fb3:A | 115 | 65 | 0.1049 | 0.1478 | 0.2615 | 0.66 | 4fb3:B, 4fb3:E |
11 | 3ec6:A | 129 | 85 | 0.1790 | 0.2248 | 0.3412 | 0.94 | |
12 | 7rzb:A | 138 | 50 | 0.0988 | 0.1159 | 0.3200 | 1.2 | |
13 | 5ck5:A | 221 | 42 | 0.0988 | 0.0724 | 0.3810 | 3.8 | 5ck4:A, 5ck4:B, 5ck5:B, 5ck5:C, 5ck5:D |
14 | 7pnt:G | 325 | 72 | 0.1111 | 0.0554 | 0.2500 | 4.8 | 7pnu:G, 7pnv:G, 7pnw:G |
15 | 7p2e:G | 330 | 93 | 0.1420 | 0.0697 | 0.2473 | 5.0 | 7a5f:G6, 7a5g:G6, 7a5i:G6, 7a5k:G6, 8any:AG, 8csp:G, 8csq:G, 8csr:G, 8css:G, 8cst:G, 8csu:G, 3j9m:AG, 8k2a:SI, 7l08:AG, 6nu2:AG, 6nu3:AG, 7og4:AG, 8oir:Ag, 8ois:Ag, 7pnx:G, 7pny:G, 7pnz:G, 7po0:G, 7po1:G, 7po2:G, 7po3:G, 7qi4:AG, 7qi5:AG, 7qi6:AG, 8qrk:G, 8qrl:G, 8qrm:G, 8qrn:G, 6rw4:G, 6rw5:G, 6vlz:AG, 6vmi:AG, 8xt0:SI, 8xt2:SI, 6zm5:AG, 6zm6:AG, 6zs9:AG, 6zsa:AG, 6zsb:AG, 6zsc:AG, 6zsd:AG, 6zse:AG, 6zsg:AG |
16 | 4xru:C | 424 | 54 | 0.0864 | 0.0330 | 0.2593 | 6.9 | 4xru:F |
17 | 6sga:CH | 222 | 14 | 0.0679 | 0.0495 | 0.7857 | 7.2 | 7pua:CH, 6sgb:CH |
18 | 6hiv:CH | 273 | 14 | 0.0679 | 0.0403 | 0.7857 | 7.2 | 6hiw:CH, 6hiy:CH, 7pub:CH |
19 | 7aor:c | 263 | 14 | 0.0679 | 0.0418 | 0.7857 | 7.3 | |
20 | 7bu5:A | 84 | 19 | 0.0679 | 0.1310 | 0.5789 | 8.4 | |
21 | 6cj0:A | 253 | 58 | 0.0988 | 0.0632 | 0.2759 | 9.1 | 6cj0:B, 6d3w:A, 6d3w:B |