BioLiP

>protein
AHFFEGTEKLLEVWFSRQQPQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSE

The query sequence (length=61) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1jl0:B	311	60	0.9344	0.1833	0.9500	2.24e-33	3dz2:B, 3dz2:A, 3dz3:B, 3dz3:A, 3dz4:B, 3dz4:A, 3dz5:B, 3dz5:A, 3dz6:B, 3dz6:A, 3dz7:B, 3dz7:A, 3ep3:A, 3ep4:A, 3ep5:A, 3ep6:B, 3ep6:A, 3ep7:B, 3ep7:A, 3ep8:B, 3ep8:A, 3ep9:A, 3epa:A, 3epb:A, 3h0v:B, 3h0v:A, 3h0w:B, 3h0w:A, 1i72:B, 1i72:A, 1i79:B, 1i79:A, 1i7b:B, 1i7b:A, 1i7c:A, 1i7c:B, 1i7m:A, 1i7m:B, 1i7m:C, 1i7m:D, 1jl0:A
2	8tl6:B	353	21	0.1475	0.0255	0.4286	0.68
3	4wbd:A	540	51	0.2459	0.0278	0.2941	5.4
4	3fsr:A	352	14	0.1475	0.0256	0.6429	5.6	3fsr:C, 3ftn:A, 3ftn:B, 3ftn:C, 3ftn:D
5	6sch:C	355	14	0.1475	0.0254	0.6429	5.6	2b83:A, 2b83:B, 2b83:C, 2b83:D, 1jqb:A, 1jqb:B, 1jqb:C, 1jqb:D, 1kev:A, 1kev:B, 1kev:C, 1kev:D, 1ped:A, 1ped:B, 1ped:C, 1ped:D, 6sch:A, 6sch:B, 6sch:D
6	7mq8:NH	1066	17	0.1475	0.0084	0.5294	5.6	7mqa:NH
7	3fpc:A	352	15	0.1475	0.0256	0.6000	6.3	3fpc:B, 3fpc:C, 3fpc:D
8	2oui:A	360	15	0.1475	0.0250	0.6000	6.3	2oui:B, 2oui:C, 2oui:D, 1y9a:A, 1y9a:C
9	8phn:A	124	40	0.1803	0.0887	0.2750	6.9
10	7uk7:A	389	19	0.1475	0.0231	0.4737	8.4

[Back]