>protein
AGTVMDHDKIAKLPASGSPLETKFQPQLHIGNGCHSYPAVDAQGNWSGGLKPTGAPSAACKDTSKAQTYVRSATFQGKTA
LVYAWYMPKDEISTGIGHRHDWEGAVVFLNSDTQQIDGVAASAHGKWRKYPNPGGANIDDTHVKLQYSAEPVINSHALDL
TDKGGDLPTLASWEGMGADARAAINERSHWGDANPPIADSLIGSSLSGAWMW
The query sequence (length=212) is searched through a non-redundant set of database sequences
protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # |
Hit |
Hit
length |
Aligned
length |
Identity
(normalized by query) |
Identity
(normalized by hit) |
Identity (normalized
by aligned length) |
E-value |
Homologs
to hit |
| 1 |
3st1:A |
212 |
212 |
1.0000 |
1.0000 |
1.0000 |
2.69e-158 |
|
| 2 |
5no9:B |
212 |
204 |
0.4151 |
0.4151 |
0.4314 |
2.07e-47 |
3gnz:P, 5nnw:A, 5nnw:B, 5nnw:C, 5nnw:D, 5no9:A, 5no9:C, 5no9:D, 6qbd:A, 6qbd:B |
| 3 |
8dgc:A |
2028 |
43 |
0.0849 |
0.0089 |
0.4186 |
0.30 |
8dgc:B, 8dgc:C, 8dgc:D |
| 4 |
6cer:D |
331 |
55 |
0.0755 |
0.0483 |
0.2909 |
0.90 |
6cer:B, 6cer:H, 6cer:F, 6cfo:D, 6cfo:B, 3exe:D, 3exe:B, 3exe:H, 3exe:F, 3exf:D, 3exf:B, 3exf:H, 3exf:F, 3exh:D, 3exh:B, 3exh:H, 3exh:F, 1ni4:D, 1ni4:B, 2ozl:D, 2ozl:B |
| 5 |
7f4v:aB |
725 |
84 |
0.1085 |
0.0317 |
0.2738 |
2.5 |
7f4v:bB, 7f4v:cB |
| 6 |
1pyt:B |
309 |
24 |
0.0519 |
0.0356 |
0.4583 |
9.8 |
2abz:A, 2abz:B, 1arm:A, 1bav:A, 1bav:B, 1bav:C, 1bav:D, 1cbx:A, 1cps:A, 1cpx:A, 3cpa:A, 4cpa:A, 4cpa:B, 5cpa:A, 6cpa:A, 7cpa:A, 8cpa:A, 2ctb:A, 2ctc:A, 1ee3:P, 1ell:P, 1elm:P, 1f57:A, 3fvl:A, 3fvl:C, 3fvl:E, 3fx6:A, 3fx6:C, 3fx6:E, 1hdq:A, 1hdu:A, 1hdu:B, 1hdu:D, 1hdu:E, 1hee:A, 1hee:B, 1hee:D, 1hee:E, 3hlp:A, 3hlp:B, 3huv:A, 3i1u:A, 1iy7:A, 3kgq:A, 1m4l:A, 2rfh:A, 1yme:A, 1zlh:A |
[Back]
umich.edu