AGIMRDHIINLLKEGKRIDDRGFEDYRPIEIEVGVIEKAEGSALVKLGSTQVLVGIKTSLGEPFPDTPNMGVMTTNVELV
PLASPTFEPGPPDERAIELARVIDRGIRESKALNLEKMVIVPGKIVRVVFIDVHVLDHDGNLMDAIGIAAIAALLNARVP
KVRYNEETGEVETLDETEPLPVEKIPVPVTFAKIGNILVVDPSLDEELVMDGKITITTDETGHISAVQKSEGGAFKLEEV
MYAVETAFKKAEEIRKLILEAVEKAKQ
The query sequence (length=267) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2pnz:B | 267 | 267 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 3m85:I | 259 | 240 | 0.4944 | 0.5097 | 0.5500 | 1.62e-75 | 3m7n:I, 3m7n:G, 3m7n:H, 3m85:G, 3m85:H |
3 | 4ba2:A | 274 | 258 | 0.4532 | 0.4416 | 0.4690 | 2.08e-73 | 2c37:I, 2c37:U, 2c38:G, 2c38:I, 2c38:U, 2c38:W, 2jea:A |
4 | 6d6q:C | 265 | 256 | 0.3483 | 0.3509 | 0.3633 | 1.72e-50 | 6d6r:C |
5 | 6d6q:A | 287 | 267 | 0.3483 | 0.3240 | 0.3483 | 1.48e-41 | 6d6r:A |
6 | 4ifd:A | 300 | 270 | 0.3146 | 0.2800 | 0.3111 | 1.39e-37 | 6fsz:AA |
7 | 2wnr:B | 222 | 146 | 0.1536 | 0.1847 | 0.2808 | 4.93e-10 | 2wnr:D, 2wnr:F |
8 | 2pnz:A | 236 | 148 | 0.1685 | 0.1907 | 0.3041 | 1.28e-08 | 2po0:A, 2po1:A, 2po2:A |
9 | 3m7n:E | 248 | 261 | 0.2472 | 0.2661 | 0.2529 | 1.72e-08 | 3m7n:F, 3m7n:D, 3m85:F, 3m85:D, 3m85:E |
10 | 2c39:D | 248 | 95 | 0.1049 | 0.1129 | 0.2947 | 6.84e-08 | 4ba1:B, 4ba2:B, 2c37:B, 2c37:F, 2c37:N, 2c37:V, 2c37:X, 2c38:B, 2c38:F, 2c38:H, 2c38:J, 2c38:N, 2c38:V, 2c38:X, 2c39:B, 2c39:F, 2c39:H, 2c39:J, 2c39:L, 2c39:N, 2c39:P, 2c39:R, 2c39:T, 2c39:V, 2c39:X, 2jea:B |
11 | 1r6m:A | 236 | 248 | 0.2247 | 0.2542 | 0.2419 | 9.56e-08 | |
12 | 3dd6:A | 244 | 148 | 0.1536 | 0.1680 | 0.2770 | 1.62e-05 | |
13 | 6d6q:B | 241 | 162 | 0.1610 | 0.1784 | 0.2654 | 1.06e-04 | 6d6r:B |
14 | 7ld5:A | 587 | 49 | 0.0861 | 0.0392 | 0.4694 | 1.83e-04 | 7ld5:B, 7ld5:C |
15 | 8wx0:A | 597 | 49 | 0.0824 | 0.0369 | 0.4490 | 3.32e-04 | 8wx0:B, 8wx0:C |
16 | 1e3p:A | 645 | 56 | 0.0899 | 0.0372 | 0.4286 | 0.001 | |
17 | 1e3p:A | 645 | 141 | 0.1461 | 0.0605 | 0.2766 | 8.8 | |
18 | 4aim:A | 698 | 45 | 0.0749 | 0.0287 | 0.4444 | 0.004 | 4aid:A, 4aid:B, 4aid:C, 4am3:A, 4am3:C, 4am3:B |
19 | 5yjj:A | 442 | 152 | 0.1685 | 0.1018 | 0.2961 | 0.005 | 5yjj:B, 5yjj:C, 5yjj:D, 5yjj:E, 5yjj:F |
20 | 6fsz:BB | 244 | 152 | 0.1311 | 0.1434 | 0.2303 | 0.070 | 4ifd:B, 5jea:B, 5k36:B, 8qcf:C |
21 | 3gme:A | 482 | 152 | 0.1461 | 0.0809 | 0.2566 | 0.32 | |
22 | 7ogk:A | 695 | 38 | 0.0599 | 0.0230 | 0.4211 | 0.52 | 3gcm:A, 3gcm:B, 3gcm:C, 3h1c:A, 3h1c:B, 3h1c:C, 3h1c:K, 3h1c:G, 3h1c:I, 3h1c:M, 3h1c:O, 3h1c:R, 3h1c:T, 3h1c:V, 3h1c:X, 7ogk:B, 7ogk:C, 7ogm:L, 7ogm:N, 7ogm:O |
23 | 4oo1:E | 255 | 206 | 0.1498 | 0.1569 | 0.1942 | 0.60 | |
24 | 6d6q:F | 252 | 76 | 0.0787 | 0.0833 | 0.2763 | 1.5 | 6d6r:F |
25 | 6s48:A | 235 | 56 | 0.0749 | 0.0851 | 0.3571 | 8.5 | 6g3b:A, 6g3b:B, 6s48:B, 6s58:D |