BioLiP

>protein
AGEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGENLDCSFDM
EAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREK
NLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALK

The query sequence (length=203) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3bu8:B	207	203	1.0000	0.9807	1.0000	2.64e-151	3bu8:A, 3bua:A, 3bua:D, 3bua:B, 3bua:C, 7c5d:A, 7c5d:B, 6j67:A, 4m7c:A, 4m7c:B, 4rqi:A, 4rqi:B, 4rqi:C, 4rqi:D, 5wqd:A, 5wqd:B, 5wqd:C, 5wqd:D, 5wqd:E, 5wqd:F, 5wqd:G
2	8w8g:C	208	192	0.2611	0.2548	0.2760	1.75e-20	3bqo:A, 8w8g:A, 8w8g:B, 8w8g:D, 5wir:B, 5wir:A, 5xup:A, 5xup:B
3	6g79:S	262	89	0.1133	0.0878	0.2584	0.078
4	6skf:BD	344	113	0.1330	0.0785	0.2389	0.078	6skg:BD, 6th6:BD
5	5v54:B	383	90	0.1133	0.0601	0.2556	0.099	7c61:A, 4iaq:A, 4iar:A, 5v54:A
6	6muu:F	323	49	0.0788	0.0495	0.3265	1.0
7	4zxf:C	307	28	0.0739	0.0489	0.5357	1.8
8	3o5b:A	479	63	0.0837	0.0355	0.2698	2.2	3o5b:B, 3o80:A, 3o8m:A
9	6ks6:Q	548	75	0.0936	0.0347	0.2533	3.0	6ks6:q, 4v81:H, 4v81:P, 4v81:h, 4v81:p, 4v8r:AQ, 4v8r:Aq, 4v8r:BQ, 4v8r:Bq, 4v94:H, 4v94:P, 4v94:h, 4v94:p, 7ylw:Q, 7ylw:q, 7ylx:Q, 7ylx:q, 7yly:Q, 7yly:q
10	8df7:A	850	80	0.1182	0.0282	0.3000	5.0	8df7:B, 8df8:A, 8df8:B, 8df9:B, 8dfb:A, 8dfb:B, 4gfj:A, 3m6k:B, 3m6z:A, 3m6z:B
11	8df9:A	781	80	0.1182	0.0307	0.3000	5.1

[Back]