AGAARSLSRFRGCLAGALLGDCVGSFYEAHDTVDLTSVLRHVEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEY
KKDPDRGYGAGVVTVFKKLLNPKCRDVFEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQLTHASSLGY
NGAILQALAVHLALQGESSSEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELG
NGIAAFESVPTAIYCFLRCMEPDPEIPSAFNSLQRTLIYSISLGGETDTIATMAGAIAGAYYGMDQVPESWQQSCEGYEE
TDILAQSLHRVFQK
The query sequence (length=334) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6d3a:A | 347 | 349 | 0.9940 | 0.9568 | 0.9513 | 0.0 | 7akr:AAA, 7akr:BBB, 7akr:CCC, 7akr:DDD, 7aks:AAA, 7aks:CCC, 7aks:EEE, 7aks:GGG, 7arw:A, 7arw:B, 6d36:C, 6d36:D, 6d36:A, 6d36:B, 6d3a:C, 6d3a:D, 6d3a:B, 2foz:A, 2fp0:A, 2fp0:B, 2g4k:A, 7l9f:C, 7l9f:D, 7l9f:A, 7l9f:B, 7l9h:C, 7l9h:D, 7l9h:A, 7l9h:B, 7l9i:C, 7l9i:D, 7l9i:A, 7l9i:B, 2qty:A, 2qty:B, 5zqy:A |
2 | 6g1q:B | 331 | 342 | 0.6437 | 0.6495 | 0.6287 | 1.59e-150 | 7aqm:A, 7aqm:B, 6g1p:A, 6g1p:B, 6g1q:A, 6hgz:A, 6hgz:B, 6hh3:A, 6hh3:B, 6hh4:A, 6hh4:B, 6hh5:A, 6hh5:B, 6hoz:A, 6hoz:B |
3 | 1t5j:A | 301 | 340 | 0.2275 | 0.2525 | 0.2235 | 1.01e-14 | |
4 | 2yzv:A | 286 | 333 | 0.2485 | 0.2902 | 0.2492 | 8.75e-14 | |
5 | 6dre:A | 365 | 339 | 0.2186 | 0.2000 | 0.2153 | 6.02e-08 | 6drh:C |
6 | 3o5t:A | 295 | 333 | 0.2126 | 0.2407 | 0.2132 | 9.31e-06 | 3g9d:A, 3g9d:B, 5ovo:A |
7 | 2woc:A | 291 | 56 | 0.0569 | 0.0653 | 0.3393 | 4.02e-05 | 2woc:B, 2woc:C, 2wod:A, 2wod:B, 2woe:A, 2woe:C, 2woe:B |
8 | 2woc:A | 291 | 131 | 0.1138 | 0.1306 | 0.2901 | 0.001 | 2woc:B, 2woc:C, 2wod:A, 2wod:B, 2woe:A, 2woe:C, 2woe:B |
9 | 4zqb:B | 316 | 141 | 0.0988 | 0.1044 | 0.2340 | 0.38 | 4zqb:A |
10 | 3mg9:A | 255 | 78 | 0.0689 | 0.0902 | 0.2949 | 1.5 | 3mgc:A |
11 | 5epo:A | 261 | 117 | 0.0868 | 0.1111 | 0.2479 | 2.2 | 5epo:B, 5epo:C, 5epo:D |
12 | 4ghl:A | 132 | 101 | 0.0719 | 0.1818 | 0.2376 | 3.9 | 4gha:A, 4gha:E, 4gha:G, 4gha:C, 4ghl:D, 4ghl:B, 4ghl:C |
13 | 8ckh:A | 281 | 57 | 0.0599 | 0.0712 | 0.3509 | 6.4 | 8ckh:B |
14 | 6g2a:A | 361 | 129 | 0.1108 | 0.1025 | 0.2868 | 6.9 | 6g28:A, 3hfw:A, 6iux:A |
15 | 2a5z:C | 244 | 77 | 0.0778 | 0.1066 | 0.3377 | 8.4 | 2a5z:A, 2a5z:B |
16 | 6sna:A | 265 | 61 | 0.0449 | 0.0566 | 0.2459 | 8.9 | 6sna:B, 6sna:F, 6sna:G, 6sna:J, 6sna:K, 6sna:N, 6sna:X |
17 | 5li6:A | 377 | 41 | 0.0479 | 0.0424 | 0.3902 | 9.3 | 5li6:B, 5li7:A, 5li7:B |
18 | 7pua:FP | 348 | 32 | 0.0359 | 0.0345 | 0.3750 | 9.4 | 6sga:FP, 6sgb:FP |
19 | 5lie:B | 397 | 41 | 0.0479 | 0.0403 | 0.3902 | 9.8 | 5li8:A, 5lie:A |