BioLiP

>protein
AFTILDVRDRSTYNDGHIMGAMAMPIEDLVDRASSSLEKSRDIYVYGAGDEQTSQAVNLLRSAGFEHVSELKGGLAAWKA
IGGPTELEHHHHHH

The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3ilm:C	126	86	0.9149	0.6825	1.0000	2.05e-59	3hix:A, 3hix:B, 3ilm:A, 3ilm:D
2	5ve5:A	350	84	0.3191	0.0857	0.3571	1.10e-08	5ve3:B, 5ve3:A, 5ve4:A, 5ve4:B, 5ve4:C, 5ve5:B, 5ve5:C
3	6mxv:B	251	85	0.2660	0.0996	0.2941	4.07e-06
4	6mxv:B	251	89	0.2766	0.1036	0.2921	5.04e-05
5	3tp9:A	473	85	0.2872	0.0571	0.3176	2.58e-04	3tp9:B
6	1yt8:A	525	79	0.2340	0.0419	0.2785	0.004
7	1yt8:A	525	86	0.2766	0.0495	0.3023	0.88
8	6pfz:A	541	55	0.2021	0.0351	0.3455	0.005	6pfz:D, 6pfz:C, 6pfz:B
9	1t3k:A	132	96	0.2766	0.1970	0.2708	0.017
10	6yub:A	423	92	0.2553	0.0567	0.2609	0.023	6yub:B, 6yuc:D, 6z6s:DDD
11	3nt6:A	565	76	0.2234	0.0372	0.2763	0.047	3nt6:B, 3nta:A, 3nta:B, 3ntd:A, 3ntd:B, 4ocg:A, 4ocg:B
12	3ict:A	557	78	0.2021	0.0341	0.2436	0.076	3icr:A, 3icr:B, 3ics:A, 3ics:B, 3ict:B
13	4v4n:Ak	212	59	0.1915	0.0849	0.3051	0.11	4v6u:Bk
14	1cws:A	178	26	0.1170	0.0618	0.4231	2.0	1cwr:A, 1cwt:A, 1qb0:A, 4wh7:A, 4wh9:A
15	7x4t:A	298	19	0.1170	0.0369	0.5789	3.5	7x4q:A, 7x4q:B, 7x4t:B
16	1orb:A	293	100	0.3085	0.0990	0.2900	4.7
17	3r2u:A	348	66	0.1596	0.0431	0.2273	7.2	3r2u:B, 3r2u:C, 3r2u:D
18	1sks:A	681	29	0.1489	0.0206	0.4828	8.9	1skr:A, 1skw:A, 1sl1:A, 1sl2:A, 1t7p:A, 1tk5:A, 1x9m:A, 1x9s:A, 1x9w:A, 1zyq:A
19	1mxs:A	216	16	0.1064	0.0463	0.6250	9.3
20	2ajq:A	704	29	0.1489	0.0199	0.4828	9.4	2ajq:F, 6n7w:H, 6p7e:A, 6p7e:B, 1t8e:A, 1tk0:A, 1tk8:A, 1tkd:A
21	6p7e:C	672	29	0.1489	0.0208	0.4828	9.6	1sl0:A, 1sl0:C

[Back]