AFEAYPPEVNSANIYAGPGPDSMLAAARAWRSLDVEMTAVQRSFNRTLLSLMDAWAGPVVMQLMEAAKPFVRWLTDLCVQ
The query sequence (length=173) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
2g38:B |
173 |
173 |
1.0000 |
1.0000 |
1.0000 |
4.26e-128 |
2g38:D |
2 |
5dpw:A |
115 |
36 |
0.0751 |
0.1130 |
0.3611 |
1.5 |
5dpw:C, 5dpw:E, 5dpw:G, 5dpw:I, 5dpw:K, 5dpw:M, 5dpw:O |
3 |
2cke:A |
301 |
62 |
0.1098 |
0.0631 |
0.3065 |
1.9 |
2cke:B, 2cke:C, 2cke:D, 2yaa:A, 2yaa:B, 2yab:A, 2yab:B |
4 |
6lce:A |
407 |
36 |
0.0751 |
0.0319 |
0.3611 |
2.1 |
6lcf:A, 6lcf:B |
5 |
2wt0:A |
300 |
30 |
0.0694 |
0.0400 |
0.4000 |
2.7 |
2wsv:A, 2wt1:A, 2wt2:A, 2wt2:B |
6 |
8e29:A |
692 |
53 |
0.0925 |
0.0231 |
0.3019 |
3.8 |
8e28:A, 8e2a:A, 4pmw:A, 4pmw:B |
7 |
1lck:A |
164 |
51 |
0.0925 |
0.0976 |
0.3137 |
4.0 |
1bhf:A, 1cwd:L, 1cwe:A, 1cwe:C, 1fbz:A, 1fbz:B, 2iim:A, 1ijr:A, 1lcj:A, 1lkk:A, 1lkl:A, 1x27:A, 1x27:B, 1x27:C, 1x27:D, 1x27:E, 1x27:F |
8 |
9fff:B |
950 |
41 |
0.0867 |
0.0158 |
0.3659 |
5.7 |
9ffb:B |
9 |
6orr:C |
273 |
50 |
0.0925 |
0.0586 |
0.3200 |
7.4 |
7bkg:A, 7bkg:B, 7bkg:C, 7bkg:D, 7ble:A, 7ble:B, 7ble:C, 7ble:D, 6chh:A, 6chh:B, 6chh:C, 6chh:D, 7egu:A, 7ehz:A, 7ei2:A, 7et7:A, 7et7:B, 7et7:C, 7et7:D, 7eu5:A, 7eu5:B, 7eu5:C, 7eu5:D, 2iip:A, 2iip:B, 2iip:C, 2iip:D, 7nbj:A, 7nbj:B, 7nbj:C, 7nbj:D, 7nbm:A, 7nbm:B, 7nbm:C, 7nbm:D, 7nbq:A, 7nbq:B, 7nbq:C, 7nbq:D, 6orr:A, 6orr:B, 6orr:D, 6pve:A, 6pve:B, 6pve:C, 6pve:D, 6pvs:A, 6pvs:B, 6pvs:C, 6pvs:D, 7rkk:A, 7rkk:B, 7rkl:A, 7rkl:B, 7rkl:C, 7rkl:D, 3rod:A, 3rod:B, 3rod:C, 3rod:D, 7sok:C, 7sok:A, 7sok:B, 7sok:D, 7wmc:A, 7wmc:B, 7wmt:A, 5xvq:A, 5xvq:B, 5yjf:A, 5yjf:B, 5yjf:C, 5yjf:D |
10 |
7mfm:G |
1483 |
51 |
0.0694 |
0.0081 |
0.2353 |
8.2 |
7mfm:H, 7mft:G |
11 |
3ts3:B |
205 |
66 |
0.1272 |
0.1073 |
0.3333 |
8.3 |
3ts3:C, 3ts3:D |