AFDESFFSFGGHVGTSVEYEDKVTRGFNNTDKKEKTITNEVFNFFYNNPQWNFMGFYSFKIENREQKEPGYYENEDGIKQ
LFSLNKGHDLGNGWATGLIYELEYTRSKVYSPDVSGLRKNLAEHSIRPYLTYWNNDYNMGFYSNLEYLLSKEDRNAWGKR
QEQGYSALFKPYKRFGNWEVGVEFYYQIKTNDEKQPDGTINEKSDFNERYIEPIVQYSFDDAGTLYTRVRVGKNETKNTD
RSGGGNAGINYFKDIRKATVGYEQSIGESWVAKAEYEYANEVEKKSRLSGWEARNKSELTQHTFYAQALYRF
The query sequence (length=312) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4v3g:A | 330 | 312 | 1.0000 | 0.9455 | 1.0000 | 0.0 | 4d5b:A, 4d5b:B, 4d5d:A, 4d5d:B, 4v3g:B, 4v3h:A, 4v3h:B |
2 | 3gyg:A | 285 | 134 | 0.1186 | 0.1298 | 0.2761 | 2.3 | 3gyg:C |
3 | 6ofr:A | 758 | 66 | 0.0513 | 0.0211 | 0.2424 | 2.8 |