AELTCTDVSGLTAEEIQMRESLQYTDHSPYPDKTCANCQLYVPAESPDQCGGCQLIKGPIHPNGYCTSWVQKAT
The query sequence (length=74) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3h31:A | 74 | 74 | 1.0000 | 1.0000 | 1.0000 | 5.62e-52 | |
2 | 1isu:A | 62 | 57 | 0.2973 | 0.3548 | 0.3860 | 1.71e-08 | 1isu:B |
3 | 1hpi:A | 71 | 63 | 0.2838 | 0.2958 | 0.3333 | 2.54e-05 | |
4 | 3hip:A | 82 | 46 | 0.2297 | 0.2073 | 0.3696 | 0.001 | 3hip:B, 3hip:C |
5 | 7a4l:A | 54 | 46 | 0.2027 | 0.2778 | 0.3261 | 0.24 | 7a58:A, 6xyv:A |
6 | 2csz:A | 76 | 44 | 0.2027 | 0.1974 | 0.3409 | 0.72 | |
7 | 1hlq:A | 75 | 78 | 0.2973 | 0.2933 | 0.2821 | 1.0 | 1hlq:B, 1hlq:C |
8 | 8wmc:A | 1249 | 29 | 0.1351 | 0.0080 | 0.3448 | 2.3 | |
9 | 8eex:A | 1284 | 29 | 0.1351 | 0.0078 | 0.3448 | 2.3 | |
10 | 7y9x:A | 1458 | 29 | 0.1351 | 0.0069 | 0.3448 | 2.4 | 8gs2:A |
11 | 7y9y:A | 1482 | 29 | 0.1351 | 0.0067 | 0.3448 | 2.4 | 8wml:A |
12 | 8eey:A | 1544 | 29 | 0.1351 | 0.0065 | 0.3448 | 2.4 | 7yna:A, 7ynb:A, 7ync:A |
13 | 8d1v:A | 1229 | 29 | 0.1351 | 0.0081 | 0.3448 | 2.5 | |
14 | 8wmi:A | 1237 | 29 | 0.1351 | 0.0081 | 0.3448 | 2.5 | |
15 | 7wah:A | 1473 | 29 | 0.1351 | 0.0068 | 0.3448 | 2.5 | |
16 | 7ynd:A | 1567 | 29 | 0.1351 | 0.0064 | 0.3448 | 2.5 | |
17 | 7yn9:A | 1514 | 29 | 0.1351 | 0.0066 | 0.3448 | 2.6 | |
18 | 8wm4:A | 1331 | 29 | 0.1351 | 0.0075 | 0.3448 | 2.6 | |
19 | 6j0x:B | 466 | 37 | 0.1216 | 0.0193 | 0.2432 | 2.8 | 6j0w:A, 6j0w:B, 6j0x:A, 6j0x:C, 6j0x:D |
20 | 7jgr:A | 401 | 51 | 0.1892 | 0.0349 | 0.2745 | 4.8 | 7jgs:A, 7jk2:A, 7jk3:A, 7jk4:A, 7jk5:A, 7jk6:A |
21 | 7bok:A | 309 | 35 | 0.1486 | 0.0356 | 0.3143 | 5.0 | 7bok:B, 7bok:C, 7bok:D, 7bok:E, 7bok:F |
22 | 8qec:A | 1101 | 31 | 0.1622 | 0.0109 | 0.3871 | 6.1 | 9f40:A, 9f40:D, 9f40:B, 9f40:C, 9f41:C, 9f41:D, 9f41:A, 9f41:B, 8qeb:A, 8qed:A, 8qee:A, 6r4l:A |
23 | 1lwh:A | 441 | 15 | 0.1081 | 0.0181 | 0.5333 | 9.2 | 1lwh:B, 1lwj:A, 1lwj:B |
24 | 7ozs:F | 571 | 15 | 0.1216 | 0.0158 | 0.6000 | 9.4 | 5aff:A, 4gmn:A |