BioLiP

>protein
AEIVTALPVPLAVAQPAPFYLTADMFGGLPVQLAGGELSKLVGKPVAAPHVHEVDELYFLVSPEPGQARIEVHLDGVRHE
LVSPAVMRIPAGSEHCFLTLEATVGSYCFGILVG

The query sequence (length=114) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7eqk:A	119	117	1.0000	0.9580	0.9744	7.83e-76	7eqk:B, 7eu6:A, 7eu6:B, 7eue:A, 7eue:B, 7eup:A, 7eup:B, 7euz:A, 7euz:B, 7f6x:A, 7f6x:B
2	6j4b:A	123	116	0.8596	0.7967	0.8448	9.83e-64	6j4c:A, 6jtf:A
3	4uob:A	242	33	0.1140	0.0537	0.3939	0.35	8a5g:A
4	2h0v:A	335	67	0.2105	0.0716	0.3582	0.58	2h0v:B, 8hfb:A, 8hfb:B, 1y3t:A, 1y3t:B
5	7vlx:Y	247	77	0.2018	0.0931	0.2987	0.63	7vlx:A, 7vlx:C, 7vly:Y, 7vly:C, 7vly:F
6	6m32:A	628	87	0.2105	0.0382	0.2759	1.3	6m32:a
7	2exh:A	533	60	0.1491	0.0319	0.2833	1.5	2exh:B, 2exh:C, 2exh:D, 2exi:A, 2exi:B, 2exi:C, 2exi:D, 2exj:A, 2exj:B, 2exj:C, 2exj:D, 2exk:A, 2exk:B, 2exk:C, 2exk:D
8	5im3:A	874	95	0.2193	0.0286	0.2632	1.6	5im3:B
9	2wjs:A	519	45	0.1316	0.0289	0.3333	2.3
10	2fl5:L	209	39	0.1404	0.0766	0.4103	2.4	2fl5:A
11	4m55:E	164	31	0.1140	0.0793	0.4194	2.9
12	8pol:B	479	25	0.0965	0.0230	0.4400	3.3	4lvn:A, 4lvo:A, 8pol:A
13	4umk:D	176	66	0.1842	0.1193	0.3182	3.4	4umk:A
14	5zqx:A	536	52	0.1316	0.0280	0.2885	3.7	5zqs:A, 5zqs:B, 5zqx:B, 5zqx:C, 5zqx:D
15	6rxx:UV	1061	34	0.1053	0.0113	0.3529	8.4
16	7t7n:B	440	18	0.0877	0.0227	0.5556	9.3	8tkz:B

[Back]