BioLiP

>protein
AEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHYMLECVCLGNGKGE
WTCKPI

The query sequence (length=86) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2rkz:C	90	90	1.0000	0.9556	0.9556	7.56e-59	3cal:A, 3cal:C, 4pz5:A, 2rkz:A, 2rkz:B, 2rkz:D, 2rkz:E, 2rkz:F, 3zrz:A, 3zrz:B
2	1o9a:A	93	48	0.5581	0.5161	1.0000	1.65e-29
3	1o9a:A	93	87	0.3140	0.2903	0.3103	7.19e-06
4	2rky:C	92	88	0.5000	0.4674	0.4886	6.58e-23	2rky:A, 2rl0:A, 2rl0:B, 2rl0:D, 2rl0:F, 2rl0:K
5	2rl0:I	79	85	0.4884	0.5316	0.4941	3.10e-21
6	3ejh:A	91	79	0.3605	0.3407	0.3924	4.52e-13	3ejh:B, 3gxe:B, 3gxe:A
7	3ejh:A	91	41	0.1628	0.1538	0.3415	0.037	3ejh:B, 3gxe:B, 3gxe:A
8	3m7p:A	301	84	0.3023	0.0864	0.3095	2.51e-06
9	3m7p:A	301	79	0.3140	0.0897	0.3418	2.56e-06
10	3m7p:A	301	41	0.1628	0.0465	0.3415	0.093
11	5bz4:K	400	46	0.1744	0.0375	0.3261	0.45	5bz4:B, 5bz4:D, 5bz4:F, 5bz4:H
12	7elh:B	1264	54	0.1744	0.0119	0.2778	0.84	1mwh:A, 1n1h:A, 1n35:A, 1n38:A, 1uon:A, 7yed:R, 7yfe:R
13	6g9f:A	539	25	0.1047	0.0167	0.3600	2.4	6g9s:A
14	3om2:A	448	41	0.1977	0.0379	0.4146	2.8	3om4:A, 3om4:B, 3om4:C, 3om4:D, 3om5:A, 3om5:B, 3om5:C, 3om5:D, 3om6:A, 3om6:B, 3om6:C, 3om6:D, 3om7:C, 3om7:A, 3om7:B, 3om7:D
15	6tix:BBB	533	24	0.1047	0.0169	0.3750	3.3	6tix:AAA
16	4bed:A	1664	23	0.1047	0.0054	0.3913	5.2	4bed:C

[Back]