AEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQCKLVVEEYYEVL
DHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELQALEARIRQKDEEDKARFR
The query sequence (length=154) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 4apo:B | 154 | 154 | 1.0000 | 1.0000 | 1.0000 | 2.82e-112 | 4aif:A, 4aif:B, 4apo:A |
| 2 | 1qz2:A | 285 | 146 | 0.2792 | 0.1509 | 0.2945 | 4.29e-10 | 1qz2:B |
| 3 | 5njx:A | 413 | 128 | 0.2078 | 0.0775 | 0.2500 | 5.12e-07 | 7a6w:AAA, 7a6w:BBB, 7a6x:AAA, 7aot:A, 7aou:A, 7apq:A, 7aps:A, 7aps:B, 7apt:A, 7apw:A, 7awf:A, 7awx:A, 7awx:B, 7b9y:A, 7b9z:A, 7ba0:A, 8ba6:A, 8baj:A, 5bxj:A, 8cca:A, 8ccb:A, 8ccc:A, 8ccd:A, 8cce:A, 8ccf:A, 8ccg:A, 8cch:A, 8chn:A, 8chp:A, 8chq:A, 8chr:A, 5dit:A, 5diu:A, 5div:A, 4drh:A, 4drh:D, 4dri:A, 4drk:A, 4drk:B, 4drm:A, 4drn:A, 4dro:A, 4drp:A, 4drq:A, 7ett:A, 7etu:A, 7etv:A, 9eu6:A, 9eu7:A, 9eu7:B, 9eu8:A, 9eu8:B, 9eu9:A, 9eu9:B, 9eua:A, 9eua:B, 9eub:A, 9eub:B, 9euc:A, 9euc:B, 9eud:A, 9eud:B, 9eue:A, 9eue:B, 9ey3:A, 9ey4:A, 4jfi:A, 4jfj:A, 4jfk:A, 4jfl:A, 4jfm:A, 3o5f:A, 3o5r:A, 5obk:A, 8pc2:G, 8pc2:H, 8pj8:A, 8pja:A, 7r0l:A, 8r5k:A, 6saf:A, 4tw6:A, 4tw7:A, 4tx0:A, 6tx4:A, 6tx5:A, 6tx6:A, 6tx7:A, 6tx9:A, 6txx:A, 4w9o:A, 4w9o:E, 4w9p:A, 4w9p:E, 4w9q:A |
| 4 | 5mgx:G | 266 | 112 | 0.2208 | 0.1278 | 0.3036 | 0.001 | 5mgx:F, 5mgx:E, 5mgx:H |
| 5 | 6fdp:A | 120 | 118 | 0.2013 | 0.2583 | 0.2627 | 0.005 | 4cgw:B, 6fdt:A |
| 6 | 4cgv:C | 126 | 116 | 0.1883 | 0.2302 | 0.2500 | 0.005 | 4cgv:D, 4cgv:A, 4cgv:B |
| 7 | 4cgw:A | 115 | 111 | 0.1948 | 0.2609 | 0.2703 | 0.007 | |
| 8 | 3kd7:A | 102 | 73 | 0.1299 | 0.1961 | 0.2740 | 0.014 | 3kd7:B, 3kd7:C, 3kd7:D, 3kd7:E |
| 9 | 6hft:A | 312 | 153 | 0.2532 | 0.1250 | 0.2549 | 0.023 | |
| 10 | 6hpg:A | 121 | 33 | 0.1039 | 0.1322 | 0.4848 | 0.026 | 6hpg:B, 6hpg:C, 6hpg:D, 6hpg:E, 6hpg:F, 6q3q:A, 6q3q:B |
| 11 | 7obe:A | 480 | 77 | 0.1558 | 0.0500 | 0.3117 | 0.034 | 7obe:B |
| 12 | 5l0y:C | 150 | 113 | 0.2013 | 0.2067 | 0.2743 | 0.15 | 5l0y:F, 5l0y:G, 5l0y:D, 5l0y:B |
| 13 | 4j7g:A | 448 | 72 | 0.1299 | 0.0446 | 0.2778 | 0.33 | 4j7g:B, 4j7h:A, 4j7h:B |
| 14 | 6kev:A | 317 | 45 | 0.1104 | 0.0536 | 0.3778 | 0.49 | |
| 15 | 4i2w:A | 904 | 93 | 0.1558 | 0.0265 | 0.2581 | 1.9 | 4i2z:A |
| 16 | 7otm:A | 3656 | 55 | 0.0974 | 0.0041 | 0.2727 | 6.8 | 7otp:A, 7otv:A, 7otw:A, 7oty:A |
| 17 | 3hdm:A | 285 | 74 | 0.1234 | 0.0667 | 0.2568 | 7.1 | 3hdn:A, 7pue:A, 2r5t:A |
| 18 | 1lf9:A | 674 | 21 | 0.0714 | 0.0163 | 0.5238 | 8.5 | 1lf9:B |
| 19 | 8u87:A | 621 | 22 | 0.0519 | 0.0129 | 0.3636 | 10.0 | 8u7y:A, 8u7y:B, 8u85:A, 8u85:C, 8u86:A, 8u86:C, 8u87:C |
umich.edu