BioLiP

>protein
AEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQCKLVVEEYYEVL
DHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAPVVSRELQALEARIRQ

The query sequence (length=144) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4apo:B	154	144	1.0000	0.9351	1.0000	1.42e-104	4aif:A, 4aif:B, 4apo:A
2	1qz2:A	285	126	0.2708	0.1368	0.3095	4.00e-10	1qz2:B
3	5njx:A	413	128	0.2222	0.0775	0.2500	5.57e-07	7a6w:AAA, 7a6w:BBB, 7a6x:AAA, 7aot:A, 7aou:A, 7apq:A, 7aps:A, 7aps:B, 7apt:A, 7apw:A, 7awf:A, 7awx:A, 7awx:B, 7b9y:A, 7b9z:A, 7ba0:A, 8ba6:A, 8baj:A, 5bxj:A, 8cca:A, 8ccb:A, 8ccc:A, 8ccd:A, 8cce:A, 8ccf:A, 8ccg:A, 8cch:A, 8chn:A, 8chp:A, 8chq:A, 8chr:A, 5dit:A, 5diu:A, 5div:A, 4drh:A, 4drh:D, 4dri:A, 4drk:A, 4drk:B, 4drm:A, 4drn:A, 4dro:A, 4drp:A, 4drq:A, 7ett:A, 7etu:A, 7etv:A, 9eu6:A, 9eu7:A, 9eu7:B, 9eu8:A, 9eu8:B, 9eu9:A, 9eu9:B, 9eua:A, 9eua:B, 9eub:A, 9eub:B, 9euc:A, 9euc:B, 9eud:A, 9eud:B, 9eue:A, 9eue:B, 9ey3:A, 9ey4:A, 4jfi:A, 4jfj:A, 4jfk:A, 4jfl:A, 4jfm:A, 3o5f:A, 3o5r:A, 5obk:A, 8pc2:G, 8pc2:H, 8pj8:A, 8pja:A, 7r0l:A, 8r5k:A, 6saf:A, 4tw6:A, 4tw7:A, 4tx0:A, 6tx4:A, 6tx5:A, 6tx6:A, 6tx7:A, 6tx9:A, 6txx:A, 4w9o:A, 4w9o:E, 4w9p:A, 4w9p:E, 4w9q:A
4	5mgx:G	266	112	0.2361	0.1278	0.3036	7.88e-04	5mgx:F, 5mgx:E, 5mgx:H
5	4cgv:C	126	116	0.2014	0.2302	0.2500	0.004	4cgv:D, 4cgv:A, 4cgv:B
6	6fdp:A	120	118	0.2153	0.2583	0.2627	0.004	4cgw:B, 6fdt:A
7	4cgw:A	115	111	0.2083	0.2609	0.2703	0.007
8	3kd7:A	102	73	0.1389	0.1961	0.2740	0.011	3kd7:B, 3kd7:C, 3kd7:D, 3kd7:E
9	6hft:A	312	142	0.2569	0.1186	0.2606	0.015
10	6hpg:A	121	33	0.1111	0.1322	0.4848	0.021	6hpg:B, 6hpg:C, 6hpg:D, 6hpg:E, 6hpg:F, 6q3q:A, 6q3q:B
11	7obe:A	480	70	0.1389	0.0417	0.2857	0.036	7obe:B
12	5l0y:C	150	113	0.2153	0.2067	0.2743	0.15	5l0y:F, 5l0y:G, 5l0y:D, 5l0y:B
13	6kev:A	317	45	0.1181	0.0536	0.3778	0.55
14	4i2w:A	904	93	0.1667	0.0265	0.2581	0.85	4i2z:A
15	4j7g:A	448	37	0.0903	0.0290	0.3514	2.1	4j7g:B, 4j7h:A, 4j7h:B
16	3hdm:A	285	74	0.1319	0.0667	0.2568	4.9	3hdn:A, 7pue:A, 2r5t:A
17	7otm:A	3656	55	0.1042	0.0041	0.2727	5.9	7otp:A, 7otv:A, 7otw:A, 7oty:A
18	1lf9:A	674	21	0.0764	0.0163	0.5238	6.4	1lf9:B
19	6m8t:A	189	15	0.0694	0.0529	0.6667	8.4	6m8u:A
20	8u87:A	621	22	0.0556	0.0129	0.3636	9.1	8u7y:A, 8u7y:B, 8u85:A, 8u85:C, 8u86:A, 8u86:C, 8u87:C
21	4lwm:A	205	34	0.0972	0.0683	0.4118	9.7

[Back]