AEAVQKFFLEEIQLGEELLAQGDYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKL
The query sequence (length=64) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1om2:A | 95 | 64 | 1.0000 | 0.6737 | 1.0000 | 1.05e-40 | 3awr:A, 3ax2:A, 3ax2:C, 3ax5:C, 2v1s:D, 2v1s:E, 2v1t:A |
2 | 5az7:A | 434 | 62 | 0.9531 | 0.1406 | 0.9839 | 1.36e-35 | 3awr:B, 3ax2:E, 3ax2:G, 3ax3:A, 3ax3:G, 3ax3:C, 3ax3:E, 3ax5:A, 5az6:B, 5az6:A, 5az8:A, 2v1s:A, 2v1s:B, 2v1s:C, 2v1s:F, 2v1t:B |
3 | 8a0m:B | 964 | 35 | 0.1562 | 0.0104 | 0.2857 | 1.4 | |
4 | 8a0m:D | 975 | 35 | 0.1562 | 0.0103 | 0.2857 | 1.4 | |
5 | 8a0c:A | 1116 | 35 | 0.1562 | 0.0090 | 0.2857 | 1.4 | 8a0c:B, 8a0m:A, 8a0m:C |
6 | 6hiy:DA | 1426 | 55 | 0.2344 | 0.0105 | 0.2727 | 3.2 | |
7 | 6hiv:DA | 1557 | 55 | 0.2344 | 0.0096 | 0.2727 | 3.3 | 6hiw:DA, 7pub:DA |
8 | 4b3g:A | 614 | 54 | 0.2344 | 0.0244 | 0.2778 | 5.2 | 4b3g:B |
9 | 2jie:A | 445 | 53 | 0.2969 | 0.0427 | 0.3585 | 5.2 | 2o9r:A, 2o9t:A, 2z1s:A |
10 | 6hxq:B | 410 | 24 | 0.1406 | 0.0220 | 0.3750 | 8.7 | |
11 | 6bvv:A | 416 | 49 | 0.2031 | 0.0312 | 0.2653 | 8.7 | 6bw9:A, 6bwa:A, 6bwb:A, 8fub:A, 8fzm:A, 8fzm:C, 8hkw:A, 8hkw:B, 7jjl:A, 7lf4:A, 7lf4:C, 7lfc:A, 7rfy:A, 7rg5:A, 5xzx:A |
12 | 7dnp:A | 174 | 34 | 0.1719 | 0.0632 | 0.3235 | 9.1 | |
13 | 8jal:B | 573 | 21 | 0.1406 | 0.0157 | 0.4286 | 9.4 | 8jal:A, 8jaq:A, 8jaq:B, 8jaq:J, 8jaq:K, 8jar:A, 8jar:B, 8jas:A, 8jas:B, 8jas:K, 8jas:J, 8jau:A, 8jau:B, 8jav:A, 8jav:B, 8jav:J, 8jav:K |