ADYKIDKEGQHAFVNFRIQHLGYSWLYGTFKDFDGTFTFDEKNPAADKVNVTINTTSVDTNHAERDKHLRSADFLNTAKY
PQATFTSTSVKKDGDELDITGDLTLNGVTKPVTLEAKLIGQGDDPWGGKRAGFEAEGKIKLKDFNIKTDLGPASQEVDLI
ISVEGVQQK
The query sequence (length=169) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1y0g:A | 169 | 169 | 1.0000 | 1.0000 | 1.0000 | 1.45e-123 | 1y0g:B, 1y0g:C, 1y0g:D |
2 | 7bwl:A | 168 | 168 | 0.7811 | 0.7857 | 0.7857 | 1.81e-98 | |
3 | 1wub:A | 176 | 163 | 0.3491 | 0.3352 | 0.3620 | 3.90e-30 | |
4 | 5w2r:A | 171 | 167 | 0.3669 | 0.3626 | 0.3713 | 1.18e-26 | 5w2z:A, 5w30:A, 5w39:A, 5w3a:A, 5w3c:A |
5 | 3hpe:A | 164 | 145 | 0.3314 | 0.3415 | 0.3862 | 2.53e-23 | 3hpe:B |
6 | 5ixg:B | 169 | 174 | 0.3491 | 0.3491 | 0.3391 | 1.51e-18 | 5ixg:C, 5ixg:A, 5ixg:D |
7 | 5ixh:B | 161 | 126 | 0.2189 | 0.2298 | 0.2937 | 2.33e-08 | 5ixh:A |
8 | 1lfw:A | 468 | 45 | 0.0947 | 0.0342 | 0.3556 | 0.11 | |
9 | 8uhe:K | 593 | 62 | 0.1124 | 0.0320 | 0.3065 | 3.0 | |
10 | 8qh3:A | 1310 | 55 | 0.1006 | 0.0130 | 0.3091 | 4.2 | 8c4u:A, 8c4v:A, 8p1m:A, 8p1n:A, 8qgt:A |
11 | 7r04:A | 2326 | 33 | 0.0769 | 0.0056 | 0.3939 | 5.8 | |
12 | 7pgr:N | 2423 | 33 | 0.0769 | 0.0054 | 0.3939 | 5.8 | 2d4q:A, 2d4q:B, 2e2x:B, 3p7z:B, 3pg7:B, 7pgq:F, 7pgr:F, 7pgs:F, 7pgt:F, 7pgu:F, 7pgu:N |