BioLiP

>protein
ADRIELRGLTVHGRHGVYDHERVAGQRFVIDVTVWIDLAEAANSDDLADTYDYVRLASRAAEIVAGPPRKLIETVGAEIA
DHVMDDQRVHAVEVAVHKPQAPIPQTFDDVAVVIRRSR

The query sequence (length=118) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1nbu:A	118	118	1.0000	1.0000	1.0000	4.19e-81	1nbu:D, 1nbu:B, 1nbu:C, 1nbu:E, 1nbu:H, 1nbu:F, 1nbu:G
2	5f3m:A	120	118	0.3475	0.3417	0.3475	3.02e-18	5f3m:B, 5far:A, 5far:B, 5far:C, 5far:D, 5far:E, 5far:H, 5far:F, 5far:G, 8sv5:A, 8sv5:G, 8sv5:B, 8sv5:H, 8sv5:C, 8sv5:D, 8sv5:F, 8sv5:E
3	2dhn:A	121	116	0.3305	0.3223	0.3362	4.14e-16	2nm2:A, 2nm2:B, 2nm2:C, 2nm2:D, 2nm3:A, 1rri:A, 1rrw:A, 1rry:A, 1rs2:A, 1rs4:A, 1rsd:A, 1rsi:A, 1u68:A
4	2o90:A	115	115	0.3051	0.3130	0.3130	1.72e-08
5	7su7:D	119	117	0.2966	0.2941	0.2991	1.30e-07	6ojo:A, 6ojo:C, 6ojo:B, 6ojo:D, 7su4:A, 7su4:D, 7su4:B, 7su4:C, 7su6:A, 7su6:C, 7su6:B, 7su6:D, 7su7:B, 7su7:A, 7su7:C, 7su8:A, 7su8:B
6	1zl9:A	207	59	0.1864	0.1063	0.3729	0.58	1zl9:B
7	3dfi:A	242	29	0.1186	0.0579	0.4828	2.2
8	8e1h:A	332	18	0.0847	0.0301	0.5556	6.3	8e1i:A, 8e1j:A, 8e1j:B, 8e1s:A, 8e1s:B, 8e1t:A, 8e1t:B, 8e1v:A
9	3eef:A	173	29	0.1017	0.0694	0.4138	9.5	3eef:B
10	1wvc:A	254	38	0.0932	0.0433	0.2895	9.6	1tzf:A

[Back]