ADRIELRGLTVHGRHGVYAHERVAGQRFVIDVTVWIDLAEAANSDDLADTYDYVRLASRAAEIVAGPPRKLIETVGAEIA
DHVMDDQRVHAVEVAVHKPQAPIPQTFDDVAVVIRRSR
The query sequence (length=118) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1nbu:A | 118 | 118 | 0.9915 | 0.9915 | 0.9915 | 4.34e-80 | 1nbu:D, 1nbu:B, 1nbu:C, 1nbu:E, 1nbu:H, 1nbu:F, 1nbu:G |
2 | 5f3m:A | 120 | 118 | 0.3475 | 0.3417 | 0.3475 | 1.72e-18 | 5f3m:B, 5far:A, 5far:B, 5far:C, 5far:D, 5far:E, 5far:H, 5far:F, 5far:G, 8sv5:A, 8sv5:G, 8sv5:B, 8sv5:H, 8sv5:C, 8sv5:D, 8sv5:F, 8sv5:E |
3 | 2dhn:A | 121 | 116 | 0.3305 | 0.3223 | 0.3362 | 2.19e-16 | 2nm2:A, 2nm2:B, 2nm2:C, 2nm2:D, 2nm3:A, 1rri:A, 1rrw:A, 1rry:A, 1rs2:A, 1rs4:A, 1rsd:A, 1rsi:A, 1u68:A |
4 | 2o90:A | 115 | 100 | 0.2627 | 0.2696 | 0.3100 | 3.26e-07 | |
5 | 7su7:D | 119 | 117 | 0.2881 | 0.2857 | 0.2906 | 2.06e-06 | 6ojo:A, 6ojo:C, 6ojo:B, 6ojo:D, 7su4:A, 7su4:D, 7su4:B, 7su4:C, 7su6:A, 7su6:C, 7su6:B, 7su6:D, 7su7:B, 7su7:A, 7su7:C, 7su8:A, 7su8:B |
6 | 1zl9:A | 207 | 59 | 0.1864 | 0.1063 | 0.3729 | 0.56 | 1zl9:B |
7 | 7jil:R | 104 | 71 | 0.1441 | 0.1635 | 0.2394 | 1.8 | |
8 | 3dfi:A | 242 | 29 | 0.1186 | 0.0579 | 0.4828 | 2.3 | |
9 | 1kc1:A | 298 | 92 | 0.1864 | 0.0738 | 0.2391 | 6.8 | 1kc3:A, 1n2s:A |
10 | 3eef:A | 173 | 29 | 0.1017 | 0.0694 | 0.4138 | 9.6 | 3eef:B |