ADPLDHLADKLFHSMGSDGVYARTALYESIVERLAALITSHREAGTEALRFPPVMSRAQLEKSGYLKSFPNLLGCVCGLH
GTEREINAAVSRFDAGGDWTTSLSPADLVLSPAACYPVYPIAASRGPLPKGGLRFDVAADCFRREPSKHLDRLQSFRMRE
YVCIGTPDDVSDFRERWMVRAQAIARDLGLTFRVDYASDPFFGRAGKMLANNQRDQQLKFELLIPLRSEEQPTACMSFNY
HREHFGTTWGIQDANGEPAHTGCVAFGMDRLAVAMFHTHGTDLSAWPAKVRDILGL
The query sequence (length=296) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3mf2:A | 299 | 296 | 0.9764 | 0.9666 | 0.9764 | 0.0 | 4h2s:A, 4h2s:B, 4h2t:A, 4h2t:B, 4h2u:A, 4h2u:B, 4h2v:A, 4h2v:B, 4h2w:A, 4h2w:B, 4h2x:A, 4h2x:B, 4h2y:A, 4h2y:B, 3mey:A, 3mf1:A, 3mf2:B, 3pzc:A |
2 | 3pzc:B | 276 | 295 | 0.9291 | 0.9964 | 0.9322 | 0.0 | 3mey:B, 3mf1:B |
3 | 3w3s:A | 527 | 292 | 0.2568 | 0.1442 | 0.2603 | 4.79e-19 | |
4 | 2cjb:B | 495 | 272 | 0.1858 | 0.1111 | 0.2022 | 1.53e-04 | 2cim:A, 2cim:B, 2cj9:A, 2cj9:B, 2cja:A, 2cja:B, 2cjb:A |
5 | 6r1n:A | 420 | 69 | 0.0811 | 0.0571 | 0.3478 | 0.096 | |
6 | 6ote:A | 409 | 68 | 0.0541 | 0.0391 | 0.2353 | 0.24 | |
7 | 6int:A | 413 | 80 | 0.0845 | 0.0605 | 0.3125 | 0.63 | 6int:B, 6int:C, 6int:D, 6int:E, 6int:F, 6int:G, 6int:H |
8 | 1wnb:A | 474 | 67 | 0.0574 | 0.0359 | 0.2537 | 1.0 | 1wnb:B, 1wnb:C, 1wnb:D, 1wnd:A, 1wnd:B, 1wnd:C, 1wnd:D |
9 | 2dq0:A | 447 | 121 | 0.0912 | 0.0604 | 0.2231 | 1.0 | 2dq0:B, 2zr2:A, 2zr2:B |
10 | 2gu2:A | 307 | 100 | 0.0946 | 0.0912 | 0.2800 | 1.2 | 2gu2:B, 2q4z:B |
11 | 1i7e:A | 237 | 61 | 0.0676 | 0.0844 | 0.3279 | 1.5 | |
12 | 5v8f:4 | 741 | 45 | 0.0507 | 0.0202 | 0.3333 | 4.1 | 5bk4:C, 5bk4:4, 6eyc:4, 6f0l:C, 3ja8:4, 7p30:4, 7p30:C, 7p5z:C, 7p5z:4, 7pt6:4, 7pt6:D, 7pt7:4, 7pt7:D, 6rqc:4, 7v3u:4, 7v3u:D, 7v3v:4, 7v3v:D, 7w8g:4, 7w8g:D |
13 | 6chs:A | 460 | 115 | 0.0912 | 0.0587 | 0.2348 | 6.2 | 6cdd:A, 6cdd:B |
14 | 2w9m:B | 559 | 47 | 0.0608 | 0.0322 | 0.3830 | 7.3 | 2w9m:A |