ADPALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPGSNDRGTRRVVTGGYGEQ
YWSPDHYATFQEIDPRC
The query sequence (length=97) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3d5i:B | 97 | 97 | 1.0000 | 1.0000 | 1.0000 | 1.74e-70 | 3d4a:B, 3dgy:A, 3dgy:B, 3dh2:A, 3dh2:B, 3dh2:C, 3dh2:D |
2 | 1gmp:A | 96 | 91 | 0.5464 | 0.5521 | 0.5824 | 2.52e-35 | 1gmp:B, 1gmr:A, 1gmr:B, 1rge:A, 1rsn:A, 1rsn:B, 2sar:A |
3 | 1gov:A | 108 | 58 | 0.2371 | 0.2130 | 0.3966 | 0.002 | 1gov:B, 1goy:A, 1goy:B |
4 | 1rnb:A | 109 | 58 | 0.1959 | 0.1743 | 0.3276 | 0.067 | 1a2p:C, 1b2z:C, 1brg:C, 1brh:C, 1brj:C, 1brk:C, 1brn:L, 1brn:M, 2f4y:C, 2f56:A, 2f56:B, 2f5m:B, 2f5m:C, 2f5w:C |
5 | 3uwq:B | 224 | 73 | 0.2784 | 0.1205 | 0.3699 | 0.18 | 3uwq:A |
6 | 7pkq:e | 176 | 44 | 0.1237 | 0.0682 | 0.2727 | 1.9 | |
7 | 8e1u:A | 1126 | 32 | 0.1134 | 0.0098 | 0.3438 | 3.4 | 8e1u:B, 8e1u:C, 8e1u:D, 8e1u:E, 8e1u:F, 8e1u:G, 8e1u:H |
8 | 8dy9:I | 303 | 28 | 0.1340 | 0.0429 | 0.4643 | 5.8 | 8dy7:I |
9 | 5o8z:B | 209 | 24 | 0.1031 | 0.0478 | 0.4167 | 6.4 | 5o8z:A, 5vxn:A, 5vxn:B, 5vxn:C, 5vxn:D, 5w43:A, 5w43:B, 6zii:B, 6zii:A, 6zix:B, 6zix:A, 6zj2:D, 6zj2:C, 6zj2:B, 6zj2:A |
10 | 5aye:A | 335 | 34 | 0.1340 | 0.0388 | 0.3824 | 6.7 | 5aye:B, 5aye:C, 5aye:D, 5aye:E, 5aye:F |
11 | 1ucr:B | 75 | 44 | 0.1134 | 0.1467 | 0.2500 | 8.0 | 1ucr:A |
12 | 4rpn:A | 219 | 36 | 0.1134 | 0.0502 | 0.3056 | 8.2 | 4rpn:D, 4rpn:C, 4rpn:B, 4rpo:A, 4rpo:B, 4rpo:C, 4rpo:D |
13 | 4ox3:A | 214 | 39 | 0.1237 | 0.0561 | 0.3077 | 8.9 | |
14 | 6zca:Y | 1127 | 31 | 0.1237 | 0.0106 | 0.3871 | 9.1 | 6zfb:Y, 6zfb:y |
15 | 7f75:D | 1142 | 31 | 0.1237 | 0.0105 | 0.3871 | 9.2 | 7ckq:D |
16 | 6wvk:D | 1184 | 31 | 0.1237 | 0.0101 | 0.3871 | 9.3 | 6wvj:D |