ADPALADVCRTKLPSQAQDTLALIAKNGPYPYNRDGVVFENRESRLPKKGNGYYHEFTVVTPDRGTRRVVTGGYGEQYWS
PDHYATFQEIDPRC
The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3d5i:B | 97 | 97 | 1.0000 | 0.9691 | 0.9691 | 4.32e-66 | 3d4a:B, 3dgy:A, 3dgy:B, 3dh2:A, 3dh2:B, 3dh2:C, 3dh2:D |
2 | 1gmp:A | 96 | 91 | 0.5532 | 0.5417 | 0.5714 | 2.99e-32 | 1gmp:B, 1gmr:A, 1gmr:B, 1rge:A, 1rsn:A, 1rsn:B, 2sar:A |
3 | 1gov:A | 108 | 57 | 0.2447 | 0.2130 | 0.4035 | 2.36e-04 | 1gov:B, 1goy:A, 1goy:B |
4 | 1rnb:A | 109 | 57 | 0.1915 | 0.1651 | 0.3158 | 0.055 | 1a2p:C, 1b2z:C, 1brg:C, 1brh:C, 1brj:C, 1brk:C, 1brn:L, 1brn:M, 2f4y:C, 2f56:A, 2f56:B, 2f5m:B, 2f5m:C, 2f5w:C |
5 | 2xe4:A | 721 | 66 | 0.2128 | 0.0277 | 0.3030 | 3.7 | |
6 | 5aye:A | 335 | 34 | 0.1383 | 0.0388 | 0.3824 | 6.2 | 5aye:B, 5aye:C, 5aye:D, 5aye:E, 5aye:F |
7 | 4ox3:A | 214 | 39 | 0.1277 | 0.0561 | 0.3077 | 8.3 |