Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
ADLAFEAKSARDYAWYDVSSFLTYRVLRTGELEVRVRFSGDEWVNVKTSVRERSIPVEPSECGRVNVGDLLLCFQEREQA
LYCDGHVLNIKRGIHDHARCNCVFLVRYELDNTEESLGLERICRRPE

The query sequence (length=127) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 4iup:B 134 133 0.9843 0.9328 0.9398 6.07e-87 4iup:A, 4iuq:B, 4iuq:A, 4iur:B, 4iur:A, 4iut:B, 4iut:A, 4iuu:B, 4iuu:A, 4iuv:A, 4iuv:B
2 7ef1:A 148 129 0.5827 0.5000 0.5736 6.41e-47 7eez:A, 7ef0:A, 7ef0:B, 7ef1:B, 7ef2:A, 7ef2:B, 7ef3:A, 7ef3:B
3 4f9g:A 170 54 0.1260 0.0941 0.2963 0.65 6mx3:A
4 4nhd:D 318 39 0.1181 0.0472 0.3846 1.1 4nhd:A, 4nhd:B, 4nhd:C
5 8d1u:A 318 44 0.1339 0.0535 0.3864 1.8 5bnm:A, 5bnr:A, 5bns:A, 5bns:B, 1ebl:A, 1ebl:B, 2eft:A, 2eft:B, 2gyo:A, 1hnd:A, 1hnh:A, 1hnj:A, 1mzs:A, 6x7r:A, 4z8d:A, 4z8d:B
6 8vda:A 311 41 0.1102 0.0450 0.3415 4.3
7 5jpq:y 157 25 0.0945 0.0764 0.4800 5.5 4bts:AQ, 4bts:BQ, 4bts:CQ, 4bts:DQ, 4v5o:AQ, 4v5o:BQ
8 4o7p:B 451 45 0.1260 0.0355 0.3556 7.2

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218