BioLiP

>protein
ADKPVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPG
GVPVKGSRYAPNR

The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7f3i:A	93	93	1.0000	1.0000	1.0000	6.17e-64	7f3i:C, 7f3i:E, 7f3j:A, 7f3j:C, 7f3j:E, 7f3j:G, 7f3k:A, 7f3l:A
2	6a6j:A	90	89	0.8710	0.9000	0.9101	1.67e-56	6a6j:C, 6a6l:A, 6ktc:A, 6kug:A, 6lmr:A, 5yts:A, 5ytt:A, 5ytv:A, 5ytx:A
3	5udz:A	139	98	0.4301	0.2878	0.4082	9.92e-16	8ops:B, 8opt:B, 8ost:B, 3trz:A, 3trz:B, 3trz:C, 3trz:D, 3trz:E, 3trz:F, 3ts0:A, 3ts0:B, 3ts2:A, 3ts2:B, 5udz:B
4	4a75:A	89	82	0.3763	0.3933	0.4268	4.02e-14	4a75:C, 4a75:E, 4a75:G, 4a76:A, 4a76:G, 4a76:C, 4a76:E, 4alp:A, 4alp:D
5	2es2:A	67	66	0.3011	0.4179	0.4242	1.60e-11	3pf4:B, 3pf5:B, 3pf5:A
6	7ot5:B	66	68	0.3011	0.4242	0.4118	4.53e-11
7	1c9o:A	66	66	0.3011	0.4242	0.4242	3.74e-10	1c9o:B, 2hax:A, 2hax:B
8	7oii:B	39	37	0.1935	0.4615	0.4865	6.90e-07
9	7dm1:B	334	60	0.1935	0.0539	0.3000	0.14	7dm1:A, 7dm2:A, 1pc3:A, 1pc3:B
10	3q4r:A	170	52	0.1613	0.0882	0.2885	0.69	3q4o:A, 3q4q:A
11	3wem:A	830	42	0.1505	0.0169	0.3333	4.0	3w37:A, 3wel:A, 3wen:A, 3weo:A
12	5yo9:B	366	37	0.1505	0.0383	0.3784	4.9	5yoa:B
13	8fqc:A	168	48	0.1613	0.0893	0.3125	5.7
14	2vn0:A	464	26	0.1075	0.0216	0.3846	6.0	2nnh:A, 2nnh:B, 2nni:A, 2nnj:A, 1pq2:A, 1pq2:B
15	6ueb:A	2099	27	0.1290	0.0057	0.4444	7.2
16	6rxd:A	509	54	0.1613	0.0295	0.2778	8.2	6rxd:B, 6rxe:A, 6rxe:B, 6rxf:A, 6rxf:B, 6rxg:A, 6rxg:B
17	5lj3:C	882	62	0.2043	0.0215	0.3065	8.2	6exn:C, 5gam:C, 5gan:C, 5lj5:C, 5lqw:B, 5mps:C, 5mq0:C, 5nrl:C
18	6iqj:B	131	30	0.1398	0.0992	0.4333	8.4	6iqj:A

[Back]