ADKHEVLLRMRAIELLAYWEGRLVTTRLMNWFGLSRQQASADIKRYNTLYNPDALIHDPSVKGYVPKASFQPVLTTAHIN
EYLNMLSGLVSESHALIAMPEPNLAAVQLPDRSVRPEVIREVLRACRNQSTLKMIYASMQNPQWHERIISPHTLVYTGFR
WHVRAYCHQSKQFKDFLLSRIDRTPVVVAIESVDPAQDQQWHEEIVLTLIPNPKLNSSQQALVEKDFGMPDGRLQIPVKK
ALAHYTLQRYQTAITLAEAEDALKYPLVLQRSDIEKL
The query sequence (length=277) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7t8k:A | 286 | 277 | 1.0000 | 0.9685 | 1.0000 | 0.0 | 7t8k:B |
2 | 2wab:A | 327 | 66 | 0.0758 | 0.0642 | 0.3182 | 0.48 | 2wao:A |
3 | 7xg9:A | 286 | 39 | 0.0433 | 0.0420 | 0.3077 | 4.1 | 7xg9:B, 7xlf:A, 7xlf:B |
4 | 6ywe:8 | 331 | 105 | 0.1119 | 0.0937 | 0.2952 | 4.4 | 6yws:8, 6ywv:8, 6ywx:8, 6ywy:8 |
5 | 1g8s:A | 230 | 41 | 0.0397 | 0.0478 | 0.2683 | 5.0 | |
6 | 8atu:A | 2837 | 54 | 0.0686 | 0.0067 | 0.3519 | 6.6 | 8atu:B, 8atx:A, 8atx:B, 8auk:A, 8auk:B, 8auw:B |