BioLiP

>protein
ADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEHLQLTFTGFFEVL
LVKVCHKKRKDVSCPIRQVLAVSSNEFEPSNSHMVKSYSLLFRVFVAQMTVFDKNRRLQLLDGEYEVAMQEKKRATWEPT
LQFTLKSTAPIAKPLAQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARI
DVSINECYDDIHRQPGFAFSRNGPVKRTPITHILVCRP

The query sequence (length=278) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6nq3:B	291	291	0.9928	0.9485	0.9485	0.0
2	8tb9:D	443	315	0.9317	0.5847	0.8222	3.36e-178	6c23:A, 6c23:Q, 6c24:A, 6c24:Q, 5wai:B, 5wai:F
3	7kso:C	420	304	0.9137	0.6048	0.8355	1.41e-173	6nq3:F
4	5wak:B	196	277	0.6942	0.9847	0.6968	6.16e-124
5	4aq0:A	765	81	0.0719	0.0261	0.2469	0.73	4aq0:B, 2xsg:A, 2xsg:B
6	5hfi:A	202	63	0.0683	0.0941	0.3016	1.3
7	7shg:A	591	135	0.1079	0.0508	0.2222	1.8	7shg:B
8	8z8x:B	710	41	0.0540	0.0211	0.3659	5.5	8z90:B
9	8z9h:B	676	41	0.0540	0.0222	0.3659	6.0	8p0b:B, 8p0g:B, 8p0u:B, 8z85:B, 8z8j:B, 8z8n:B, 8z97:B, 8z9h:I, 8z9r:B, 8z9r:I
10	8z98:B	647	41	0.0540	0.0232	0.3659	6.3	8z9q:B
11	8tnq:C	35	31	0.0432	0.3429	0.3871	7.1	8tnp:C, 8tnr:C
12	1vs1:D	271	30	0.0432	0.0443	0.4000	8.1	1vs1:A, 1vs1:B, 1vs1:C
13	7vw6:A	913	67	0.0683	0.0208	0.2836	9.6	7e5z:A, 8j83:A, 7xqw:A

[Back]