ADGRSTRYWNCCKPSCGWAKKAPVNQPVFSCNANFQRITDFDAKSGCEPGGVAYSCADQTPWAVNDDFALGFAATSIAGS
NEAGWCCACYELTFTSGPVAGKKMVVQSTSTGGDLGSNHFDLNIPGGGVGIFDGCTPQFGGLPGQRYGGISSRNECDRFP
DALKPGCYWRFDWFKNADNPSFSFRQVQCPAELVARTGCRRNDDGNFPAV
The query sequence (length=210) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3eng:A | 213 | 210 | 0.9952 | 0.9812 | 0.9952 | 5.82e-155 | 4eng:A |
2 | 1oa7:A | 207 | 207 | 0.7810 | 0.7923 | 0.7923 | 5.69e-123 | |
3 | 5gly:A | 213 | 207 | 0.7381 | 0.7277 | 0.7488 | 2.05e-117 | 5gm9:A |
4 | 6mvj:A | 213 | 207 | 0.6952 | 0.6854 | 0.7053 | 6.50e-112 | |
5 | 4ylf:B | 468 | 85 | 0.1143 | 0.0513 | 0.2824 | 3.8 | 4ylf:D, 4yry:B, 4yry:D |
6 | 7qh2:C | 467 | 41 | 0.0667 | 0.0300 | 0.3415 | 7.7 | 7qh2:F |
7 | 6drt:A | 230 | 31 | 0.0619 | 0.0565 | 0.4194 | 8.6 | 6drt:B, 6drt:C |