BioLiP

>protein
ADGAKIYAQCAGCHQQNGQGIPGAFPPLAGHVAEILAKEGGREYLILVLLYGLQGQIEVKGMKYNGVMSSFAQLKDEEIA
AVLNHIATAWGDAKKVKGFKPFTAEEVKKLRAKKLTPQQVLAERKKLGLK

The query sequence (length=130) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1c52:A	131	130	1.0000	0.9924	1.0000	2.44e-92	1dt1:A, 1foc:A, 1foc:B, 2fwl:A, 1qyz:A, 1r0q:A, 3vnw:A
2	4ax3:D	457	104	0.3154	0.0897	0.3942	6.75e-18	4ax3:A, 4ax3:B, 4ax3:C, 6f1q:A, 6fja:A, 5obo:A, 5ocb:A, 5ocf:A, 8qgf:A, 6qpt:A, 6qpt:B, 6qpt:C, 6qpt:D, 6qpt:E, 6qpt:F, 6qpu:A, 6qpu:B, 6qpu:C, 6qpu:D, 6qpu:E, 6qpu:F, 6qpv:A, 6qpv:I, 6qpx:A, 6qpx:I, 6qpz:A, 6qpz:I, 6qq0:A, 6qq1:A, 6qq2:A, 7qq2:A, 7r2u:A, 2yqb:A, 3zbm:A, 3ziy:A
3	2zoo:A	438	117	0.3538	0.1050	0.3932	2.93e-15
4	8hdd:B	121	112	0.2846	0.3058	0.3304	1.95e-08
5	7w2j:C	418	115	0.2769	0.0861	0.3130	2.91e-06	8jej:C, 8jek:C, 8k6j:C, 8k6k:C, 7w2j:F, 7wsq:C, 7wsq:F, 8xcm:C, 8xcn:C
6	8gy2:B	433	120	0.2615	0.0785	0.2833	3.83e-05
7	1dvh:A	79	40	0.1308	0.2152	0.4250	0.022	2dvh:A, 1dwl:B, 1e08:E
8	8smr:K	181	78	0.1769	0.1271	0.2949	0.43	6q2u:A, 8smr:N, 8snh:K, 8snh:N
9	5n1t:B	75	91	0.1923	0.3333	0.2747	0.52
10	1c53:A	79	19	0.0769	0.1266	0.5263	0.56
11	7vzg:c	145	16	0.0846	0.0759	0.6875	0.59	7vzr:c
12	6jxn:B	212	53	0.1385	0.0849	0.3396	0.82	6jxn:A, 6jxn:C, 6jxn:D, 6jxs:A, 6jxs:B, 6jxs:C, 6jxs:D
13	8uo8:A	574	53	0.1077	0.0244	0.2642	1.1
14	7tlx:1	102	26	0.0769	0.0980	0.3846	1.6
15	8uf3:A	187	101	0.2154	0.1497	0.2772	1.6	8uf3:B
16	1kkm:B	177	23	0.0846	0.0621	0.4783	2.2	1kkl:A, 1kkl:B, 1kkl:C, 1kkm:A, 1kkm:C
17	2xpy:A	628	31	0.0769	0.0159	0.3226	2.4	2xpz:A, 2xq0:A
18	4gfr:A	529	39	0.1231	0.0302	0.4103	2.6	8i5j:A, 8i5j:B, 8i5k:A, 1zu0:A
19	7aih:Aq	258	30	0.1000	0.0504	0.4333	3.1	7ane:Aq
20	3m97:X	118	44	0.1154	0.1271	0.3409	4.5	1c7m:A, 1i6d:A, 1i6e:A, 1ql3:A, 1ql3:B, 1ql3:C, 1ql3:D, 1ql4:A, 1ql4:B, 1ql4:C, 1ql4:D
21	1w2l:A	97	93	0.2154	0.2887	0.3011	5.1
22	8jxu:A	1410	30	0.1000	0.0092	0.4333	5.6	8jxq:A
23	1etp:A	190	31	0.1077	0.0737	0.4516	6.2	1etp:B, 1m6z:A, 1m6z:B, 1m6z:C, 1m6z:D, 1m70:A, 1m70:B, 1m70:C, 1m70:D
24	3h70:A	342	49	0.1077	0.0409	0.2857	6.8
25	7mqa:ST	570	28	0.0923	0.0211	0.4286	7.3	7mq8:ST, 7mq9:ST
26	5e9h:A	518	39	0.0846	0.0212	0.2821	7.7

[Back]