>protein
ADFKFEPMRSLIYVDCVSEDYRPKLQRWIYKVHIPDSISQFEPYVTKYAFYPSFPIPPQGDRFGYARMQLTEHHWLVSDL
DPRLEIKAIAETFPMDVLVWQGQIPAAEGNPFIFAFLPMWWEKDLKGKGRTIEDGANYRFNMTIGFPEGVDKAEGEKWLF
EKVVPILQAAPECTRVLASAVKKDINGCVMDWVLEIWFENQSGWYKVMVDDMKALEKPSWAQQDAFPFLKPYHNVCSAAV
ADYTPSNNLANYRGYITMR
The query sequence (length=259) is searched through a non-redundant set of database sequences
protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # |
Hit |
Hit
length |
Aligned
length |
Identity
(normalized by query) |
Identity
(normalized by hit) |
Identity (normalized
by aligned length) |
E-value |
Homologs
to hit |
| 1 |
8b7r:E |
262 |
262 |
1.0000 |
0.9885 |
0.9885 |
0.0 |
8b7r:A, 8b7r:B, 8b7r:C, 8b7r:D, 8b7r:F, 8b7u:A, 8b7u:B, 8b7u:C, 8b7u:D, 8b7u:E, 8b7u:F, 8b7u:G, 8b7u:H, 8b7u:I, 8b7u:J, 8b7u:K, 8b7u:L, 8b7u:M, 8b7u:N, 8b7u:O, 8b7u:P, 8b7u:Q, 8b7u:R, 8b7z:A, 8b7z:B, 8b7z:C, 8b7z:D, 8b7z:E, 8b7z:F, 8b7z:G, 8b7z:H, 8b7z:I, 8b7z:J, 8b7z:K, 8b7z:L, 8b7z:M, 8b7z:N, 8b7z:P, 8b7z:O, 8b7z:Q, 8b7z:R, 4d06:B, 4d06:D, 4d06:F |
| 2 |
4d06:A |
282 |
282 |
1.0000 |
0.9184 |
0.9184 |
0.0 |
4d06:C, 4d06:E |
| 3 |
6ox1:B |
484 |
94 |
0.0888 |
0.0475 |
0.2447 |
1.7 |
6ict:A, 6ict:B, 6ict:C, 6ict:D, 6icv:A, 6icv:B, 6jat:A, 6jat:C, 7lms:A, 6mbj:A, 6mbj:B, 6mbk:A, 6mbk:B, 6mbl:A, 6ox0:A, 6ox0:B, 6ox1:A, 6ox2:A, 6ox2:B, 6ox3:A, 6ox3:B, 6ox4:A, 6ox4:B, 6ox5:A, 3smt:A, 6v62:A, 6v63:A, 6v63:B, 7w28:A, 7w29:A, 6wk1:A, 6wk1:B, 6wk2:A, 6wk2:D, 8x77:B |
| 4 |
8c6o:A |
195 |
74 |
0.0811 |
0.1077 |
0.2838 |
4.4 |
8a9s:A, 8a9s:B, 8c6o:B, 1el4:A, 2f8p:A, 1jf2:A, 4mrx:A, 4mry:A, 4n1f:A, 4n1g:A, 4n1g:B, 7o3u:A, 1qv0:A, 1qv1:A, 1s36:A, 1sl7:A, 1sl9:A |
| 5 |
8jlr:R |
268 |
31 |
0.0502 |
0.0485 |
0.4194 |
7.4 |
|
| 6 |
8uhb:A |
316 |
31 |
0.0502 |
0.0411 |
0.4194 |
7.5 |
8jln:R, 8jlo:R, 8jlp:R, 8jlq:R, 8jso:R, 8w87:R, 8w88:R, 8w89:R, 8w8a:R, 8wc8:R, 8wca:R, 8zsp:R, 8zss:R |
[Back]
umich.edu