BioLiP

>protein
ADDKSGKAPVITVFDHRGCQRGGPDREYKGKKANGPDDEMCVKVQSAKIAVSATTADSVLQQTISTLYRK

The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7t8s:D	70	70	1.0000	1.0000	1.0000	1.10e-47	7t8s:H, 7t8s:L, 7t8s:P
2	7tja:G	67	69	0.5857	0.6119	0.5942	4.35e-23	7tja:Q, 7tja:C, 7tja:K, 7tja:O, 7tlf:C, 7tlf:G, 7tlf:K, 7tlf:O
3	1qgw:B	67	69	0.5571	0.5821	0.5652	5.43e-21	1xf6:B, 1xg0:B
4	7t8s:B	78	65	0.5857	0.5256	0.6308	1.22e-20	7t8s:F, 7t8s:J, 7t8s:N
5	7sut:C	63	61	0.4857	0.5397	0.5574	1.71e-16	7sut:G
6	1qgw:A	76	65	0.5143	0.4737	0.5538	3.59e-16	1xf6:A, 1xg0:A
7	7t7u:A	81	64	0.4429	0.3827	0.4844	2.97e-13
8	7tja:I	75	62	0.4429	0.4133	0.5000	5.95e-13	7tja:A, 7tja:R, 7tja:E, 7tja:M, 7tlf:A, 7tlf:E, 7tlf:I, 7tlf:M
9	4lms:C	68	66	0.4286	0.4412	0.4545	1.10e-11
10	7t7u:C	70	64	0.4000	0.4000	0.4375	3.87e-11
11	4lms:A	80	62	0.3714	0.3250	0.4194	3.84e-10
12	7sut:A	78	57	0.3286	0.2949	0.4035	4.65e-09	7sut:E
13	4lmx:E	66	66	0.3714	0.3939	0.3939	1.06e-04	8el3:C, 8el3:I, 8el3:E, 8el3:L, 8el4:C, 8el4:E, 8el5:C, 8el5:I, 8el5:E, 8el5:L, 8el6:C, 8el6:E, 4lmx:A, 4lmx:G, 4lmx:I, 4lmx:K
14	4lmx:C	66	60	0.3571	0.3788	0.4167	1.87e-04	8el3:A, 8el3:J, 8el3:G, 8el3:K, 8el4:A, 8el4:F, 8el5:A, 8el5:J, 8el5:K, 8el5:G, 8el6:A, 8el6:F
15	4lm6:A	62	58	0.3429	0.3871	0.4138	0.001	4lm6:C
16	7s96:A	63	57	0.3000	0.3333	0.3684	0.001	7s96:C, 7s97:C, 7t89:A, 7t89:C
17	7ssf:A	72	57	0.3286	0.3194	0.4035	0.001	7ssf:C, 7ssf:E, 7ssf:G
18	5viy:I	213	23	0.1571	0.0516	0.4783	0.18
19	4fp8:L	213	23	0.1429	0.0469	0.4348	1.8	4fp8:M, 4fp8:N
20	6ous:N	213	23	0.1429	0.0469	0.4348	3.0	6ous:P, 6ous:R, 6ous:T, 6ous:V, 6ous:X
21	7mxd:D	204	29	0.1429	0.0490	0.3448	3.6	8gje:L, 8gje:J, 8gje:K, 7ly9:C, 7ly9:I, 7mxd:U, 7n28:D, 7n28:K, 7n28:U, 7pc2:L, 7pc2:J, 5v8l:L, 5v8l:K, 5v8m:L, 5v8m:T, 5v8m:U
22	7m4v:D	211	37	0.2429	0.0806	0.4595	4.1	7m4w:D, 7m4x:D, 7m4y:D, 7m4z:D, 7ryf:D, 7ryg:D, 7ryh:D, 7uvv:D, 7uvw:D, 7uvx:D, 7uvy:D, 7uvz:D, 7uw1:D, 6v39:D, 6v3a:D, 6v3b:D, 6v3d:D, 6yhs:B, 6ysi:B
23	6iix:A	323	31	0.1714	0.0372	0.3871	4.6	4mfk:A, 4mfl:A, 4mfp:A, 4mfq:A, 4q36:A, 4q38:A
24	1ce1:L	211	23	0.1286	0.0427	0.3913	7.3
25	8der:L	105	31	0.1571	0.1048	0.3548	8.6

[Back]