ADALHIRFPDGAVIEYEPETSALTVSGIKTASVTASGSVTATVPVVMVKASTRVTLDTPEVVCTNRLITGTLEVQKGGTM
RGNIEHTGGELSSNGKVLHTHKHPGDSGGTTGSPL
The query sequence (length=115) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3aqj:A | 117 | 115 | 1.0000 | 0.9829 | 1.0000 | 2.32e-79 | 3aqj:B, 3aqj:C, 3aqj:P, 3aqj:Q, 3aqj:R, 3qr7:A, 3qr7:B |
2 | 3vto:B | 110 | 84 | 0.2696 | 0.2818 | 0.3690 | 3.83e-06 | 3vto:A, 3vto:C, 3vto:P, 3vto:Q, 3vto:R |
3 | 7q4v:B | 599 | 41 | 0.1478 | 0.0284 | 0.4146 | 1.4 | 8a5e:B, 7q4v:F, 7q4w:B, 7q4w:F |
4 | 5n6n:C | 698 | 33 | 0.1043 | 0.0172 | 0.3636 | 4.9 | 5m4a:A |
5 | 5cxw:A | 376 | 106 | 0.2522 | 0.0771 | 0.2736 | 6.0 | |
6 | 3h8t:A | 182 | 29 | 0.1043 | 0.0659 | 0.4138 | 6.7 | 3h8t:B |