ACQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCP
ISGRAVRDPPG
The query sequence (length=91) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6zho:A | 577 | 84 | 0.9231 | 0.1456 | 1.0000 | 1.64e-60 | 8ax5:A, 8ax6:A, 8ax7:A, 6d1u:A, 6d1u:B, 6d1u:C, 3n7r:A, 3n7r:C, 3n7r:D, 3n7r:B, 3n7s:A, 3n7s:C, 3n7s:D, 3n7s:B, 7p0f:A, 7p0i:A, 4rwg:A, 4rwg:B, 4rwg:C, 5v6y:A, 5v6y:B, 5v6y:C, 5v6y:D, 6zis:A |
2 | 4rwf:A | 555 | 69 | 0.2308 | 0.0378 | 0.3043 | 1.80e-08 | 6v2e:A, 2xvt:C, 2xvt:F |
3 | 6sl1:A | 2652 | 42 | 0.1978 | 0.0068 | 0.4286 | 0.090 | 6sky:A, 6sky:B |
4 | 6skz:A | 2638 | 42 | 0.1978 | 0.0068 | 0.4286 | 0.091 | 6sl0:A, 6sl0:B |
5 | 8a0c:A | 1116 | 32 | 0.1099 | 0.0090 | 0.3125 | 0.93 | 8a0c:B, 8a0m:A, 8a0m:C |
6 | 2gm8:A | 217 | 77 | 0.2637 | 0.1106 | 0.3117 | 2.1 | 2gm8:B, 2gm8:C, 2gm8:D |
7 | 6wt7:A | 331 | 30 | 0.1099 | 0.0302 | 0.3333 | 2.9 | |
8 | 1uwy:A | 393 | 49 | 0.1538 | 0.0356 | 0.2857 | 5.8 | |
9 | 8olx:B | 836 | 24 | 0.1209 | 0.0132 | 0.4583 | 6.4 | 8om5:B, 8om9:B |
10 | 3thw:B | 860 | 24 | 0.1209 | 0.0128 | 0.4583 | 6.4 | 8oma:B, 8omo:B, 8omq:B, 3thx:B, 3thy:B, 3thz:B |
11 | 6tf9:UP1 | 569 | 33 | 0.1319 | 0.0211 | 0.3636 | 9.2 | |
12 | 1vz4:D | 259 | 57 | 0.2088 | 0.0734 | 0.3333 | 9.4 | 1oii:A, 1oii:B, 1oii:D, 1oij:A, 1oij:B, 1oik:A, 1oik:D, 1vz4:A |