AARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWL
KKL
The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5xtc:U | 83 | 83 | 1.0000 | 1.0000 | 1.0000 | 2.44e-56 | 5xtd:U, 5xth:U, 5xti:U, 5xti:BU |
2 | 8qoy:A | 1036 | 52 | 0.1928 | 0.0154 | 0.3077 | 0.87 | |
3 | 2z86:C | 603 | 48 | 0.1446 | 0.0199 | 0.2500 | 1.9 | 2z86:A, 2z86:B, 2z86:D, 2z87:A, 2z87:B |
4 | 6tjv:F | 600 | 42 | 0.1446 | 0.0200 | 0.2857 | 1.9 | |
5 | 7r76:A | 1834 | 23 | 0.1205 | 0.0055 | 0.4348 | 2.2 | 7r77:A |
6 | 8e9i:M | 518 | 37 | 0.1928 | 0.0309 | 0.4324 | 2.2 | 8e9g:M, 8e9h:M |
7 | 2gmh:A | 581 | 36 | 0.1807 | 0.0258 | 0.4167 | 5.0 | 2gmh:B, 2gmj:A, 2gmj:B |
8 | 2x27:X | 209 | 33 | 0.1446 | 0.0574 | 0.3636 | 7.6 |