AARRCQSQLERANLRPCEQHLMQKIQRSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLP
QQCGLRAPQRCDLDV
The query sequence (length=95) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8db4:E | 95 | 95 | 1.0000 | 1.0000 | 1.0000 | 5.70e-62 | |
2 | 3ob4:A | 474 | 106 | 0.9684 | 0.1941 | 0.8679 | 2.54e-59 | |
3 | 1vf1:A | 226 | 87 | 0.2105 | 0.0885 | 0.2299 | 0.012 | 1vf2:A, 1vf2:B, 1vf3:A, 1vf3:B |
4 | 2ds2:D | 68 | 54 | 0.1895 | 0.2647 | 0.3333 | 0.51 | 2ds2:B |
5 | 5ag2:C | 195 | 34 | 0.0947 | 0.0462 | 0.2647 | 7.7 | 5ag2:A, 3dc5:A, 3dc5:C, 6elk:A, 6elk:C, 6qzm:A, 6qzm:C, 6qzn:A, 6qzn:C, 6s0d:A, 6s0d:C, 4x9q:A, 4x9q:C |