AAPLVLVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPLIIYLFHFLIDYAE
LVFMITDALTAIALYFAIQDFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCA
INNTLIAFFILTTIKGSAFLSAIFLALATYQSLYPLTLFVPGLLYLLQRQYIPVKMKSKAFWIFSWEYAMMYVGSLVVII
CLSFFLLSSWDFIPAVYGFILSVPDLTPNIGLFWYFFAEMFEHFSLFFVCVFQINVFFYTIPLAIKLKEHPIFFMFIQIA
VIAIFKSYPTVGDVALYMAFFPVWNHLYRFLRNIFVLTCIIIVCSLLFPVLWHLWIYAGSANSNFFYAITLTFNVGQILL
ISDYFYAFLRREYYLTHGLY
The query sequence (length=420) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8imx:U | 420 | 420 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8imy:U, 7w72:U, 7wld:U |
2 | 6sga:F6 | 456 | 37 | 0.0310 | 0.0285 | 0.3514 | 3.8 | 6sgb:F6 |
3 | 7pub:F6 | 416 | 37 | 0.0310 | 0.0312 | 0.3514 | 4.4 | |
4 | 8r8r:A | 1188 | 65 | 0.0452 | 0.0160 | 0.2923 | 6.8 | |
5 | 6chd:A | 506 | 23 | 0.0238 | 0.0198 | 0.4348 | 8.7 | 3bju:A, 3bju:B, 3bju:C, 3bju:D, 6chd:B, 4dpg:A, 4dpg:B, 4dpg:C, 4dpg:D, 4dpg:E, 4dpg:F, 4dpg:G, 4dpg:H, 7ea9:A, 7ea9:B, 7ea9:C, 7ea9:D, 6ild:A, 6ild:B, 6ilh:A, 6ilh:B, 4ycu:A, 4ycu:B, 4ycw:A, 4ycw:B, 4ycw:E, 4ycw:F |