BioLiP

>protein
AAPANAVTADDPTAIALKYNQDATKSERVAAARPGLPPEEQHCANCQFMQANVGEGDWKGCQLFPGKLINVNGWCASWTL
KAG

The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1js2:A	89	85	0.8795	0.8202	0.8588	1.22e-48	3a38:A, 3a39:A, 6aiq:A, 6air:A, 2ams:A, 1b0y:A, 7c52:b, 1cku:A, 1cku:B, 5d8v:A, 1eyt:A, 2fla:A, 1hip:A, 1hrq:A, 1hrr:A, 1iua:A, 1js2:B, 1js2:C, 1js2:D, 1neh:A, 1noe:A, 7vos:A, 5wqq:A, 5wqr:A
2	3hip:A	82	81	0.7470	0.7561	0.7654	1.79e-44	3hip:B, 3hip:C
3	1hpi:A	71	75	0.3373	0.3944	0.3733	8.12e-13
4	1hlq:A	75	76	0.2771	0.3067	0.3026	9.97e-06	1hlq:B, 1hlq:C
5	3h31:A	74	46	0.2289	0.2568	0.4130	5.41e-04
6	7oso:A	412	19	0.1205	0.0243	0.5263	0.45	4d47:A, 4d47:B, 4d47:C, 4d47:D, 4d47:E, 4d47:F, 4d47:G, 4d47:H, 6frw:A, 6rv5:A
7	4eb5:C	138	30	0.1687	0.1014	0.4667	0.94	4eb5:D, 4eb7:C
8	4fi4:A	407	34	0.1687	0.0344	0.4118	1.3	4fi4:B, 4fi4:C
9	1cp9:B	553	59	0.2169	0.0325	0.3051	1.5
10	6z1p:Av	206	35	0.1325	0.0534	0.3143	2.2
11	1vfs:A	383	38	0.1446	0.0313	0.3158	2.9	1vfh:A, 1vfs:B, 1vft:A, 1vft:B
12	3thu:A	405	33	0.1325	0.0272	0.3333	3.2	3thu:B, 3thu:C
13	3oa6:A	84	52	0.2048	0.2024	0.3269	4.4	3oa6:B
14	2vq2:A	220	32	0.1084	0.0409	0.2812	6.1
15	4gme:A	403	33	0.1566	0.0323	0.3939	7.1	4gme:C, 3vcn:A, 3vcn:C

[Back]