AALEVLFQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPP
The query sequence (length=121) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
7kri:A |
127 |
124 |
1.0000 |
0.9528 |
0.9758 |
1.45e-85 |
7kri:B, 7kri:C, 7n3k:A, 7n3k:B, 7n3k:C, 7n3k:D, 7n3k:E, 7n3k:F, 7n3k:G, 7n3k:H |
2 |
7mjp:A |
366 |
25 |
0.0909 |
0.0301 |
0.4400 |
3.9 |
7mit:A, 7mit:B, 7mit:C, 7mit:D, 7mjo:A, 7mjo:B, 7mjo:C, 7mjo:D, 7mjp:B, 7mjp:D, 7mjq:A, 7mjq:B, 7mjq:C |
3 |
4f4f:A |
464 |
94 |
0.2562 |
0.0668 |
0.3298 |
5.6 |
4f4f:B |
4 |
8id2:A |
95 |
22 |
0.0909 |
0.1158 |
0.5000 |
6.4 |
8id2:B, 7p0v:A |
5 |
9c20:A |
451 |
41 |
0.1157 |
0.0310 |
0.3415 |
8.3 |
8url:A, 8uvv:A |
6 |
7tys:A |
361 |
25 |
0.0826 |
0.0277 |
0.4000 |
9.8 |
6baa:A, 6baa:D, 6baa:B, 6baa:C, 6c3o:A, 6c3o:B, 6c3o:C, 6c3o:D, 6c3p:A, 6c3p:B, 6c3p:D, 6c3p:C, 6jb1:A, 6jb1:G, 6jb1:C, 6jb1:E, 8ti1:D, 8ti1:A, 8ti1:B, 8ti1:C, 8ti2:D, 8ti2:A, 8ti2:B, 8ti2:C, 5twv:A, 5twv:C, 5twv:E, 5twv:G, 7tys:D, 7tys:B, 7tys:C, 7tyt:A, 7tyt:D, 7tyt:B, 7tyt:C, 7u1e:B, 7u1e:C, 7u1e:D, 7u1e:A, 7u1q:A, 7u1q:B, 7u1q:C, 7u1q:D, 7u1s:A, 7u1s:D, 7u1s:B, 7u1s:C, 7u24:A, 7u24:D, 7u24:B, 7u24:C, 7u6y:A, 7u6y:B, 7u6y:C, 7u6y:D, 7uaa:B, 7uaa:C, 7uaa:D, 7w4p:A, 7w4p:C, 7w4p:E, 7w4p:G, 5ykf:A, 5ykf:C, 5ykf:E, 5ykf:G, 5ykg:A, 5ykg:C, 5ykg:E, 5ykg:G, 5yw8:C, 5yw8:E, 5yw8:G, 5yw8:A, 5yw9:C, 5yw9:E, 5yw9:G, 5yw9:A, 5ywa:A, 5ywa:C, 5ywa:E, 5ywa:G, 5ywb:A, 5ywb:C, 5ywb:E, 5ywb:G, 5ywc:A, 5ywc:C, 5ywc:E, 5ywc:G |