BioLiP

>protein
AACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNSRCDPACSSPACLYDNFDCERTCNPVYEKY
CADHFADGRCDQGCNTEECGWDGLDCASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAM
VFPYGSVVMLEIDNRLCLQSPDHCFPDAQSAADYLGALSAVERLDFPYPLRDVRGEPL

The query sequence (length=218) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4zlp:A	241	233	1.0000	0.9046	0.9356	2.64e-152	5czv:A, 5czx:A, 5czx:B, 6xsw:C, 6xsw:F, 6xsw:J, 6xsw:X, 4zlp:B
2	7abv:A	232	225	0.5413	0.5086	0.5244	2.60e-86	3eto:A, 3eto:B, 3i08:A, 3i08:C, 3l95:X, 3l95:Y
3	2oo4:A	226	225	0.5138	0.4956	0.4978	9.98e-69	2oo4:B
4	2oo4:A	226	29	0.0734	0.0708	0.5517	6.74e-04	2oo4:B
5	1pb5:A	35	27	0.0688	0.4286	0.5556	5.96e-04
6	1pb5:A	35	27	0.0505	0.3143	0.4074	4.6
7	8hgg:C	1484	59	0.0872	0.0128	0.3220	0.13	8hgg:D, 8hgh:A, 8hgh:B
8	8hgg:C	1484	24	0.0642	0.0094	0.5833	0.20	8hgg:D, 8hgh:A, 8hgh:B
9	8hgg:C	1484	31	0.0596	0.0088	0.4194	5.8	8hgg:D, 8hgh:A, 8hgh:B
10	4lfl:B	172	28	0.0596	0.0756	0.4643	0.14	4lfl:D, 4lfm:B, 4lfm:D, 4lfn:B, 4lfn:D
11	8a7e:C	1524	59	0.0872	0.0125	0.3220	0.14	8a7d:C, 8a7e:Q, 7y5n:C, 7y5q:B
12	8a7e:C	1524	24	0.0642	0.0092	0.5833	0.21	8a7d:C, 8a7e:Q, 7y5n:C, 7y5q:B
13	8a7e:C	1524	31	0.0596	0.0085	0.4194	6.2	8a7d:C, 8a7e:Q, 7y5n:C, 7y5q:B
14	8oxm:A	2748	19	0.0413	0.0033	0.4737	2.9	8oxm:B
15	7sic:A	2773	19	0.0413	0.0032	0.4737	3.0	8oxo:A, 8oxo:B, 8oxp:A, 8oxp:B, 7sic:B, 7sid:A, 7sid:C
16	7ni5:A	2791	19	0.0413	0.0032	0.4737	3.0	7ni4:A, 7ni4:B, 7ni5:B, 7ni6:A, 7ni6:B, 8oxq:A, 8oxq:B
17	8a7d:Q	273	31	0.0596	0.0476	0.4194	8.9
18	5wg6:A	517	47	0.0826	0.0348	0.3830	9.6	5wg6:C

[Back]