# | PDB (resolution) |
Site # |
Peptide
sequence |
EC number |
GO terms |
UniProt | PubMed | Binding affinity |
---|---|---|---|---|---|---|---|---|
36301 | 8jcb:a (9.5) |
BS01 | >8jcb:b (identical to 8jc0:b, 8jcb:B, 8wxe:b, 8wyi:b)LDPKLCYLLDGILFIYGVILTALFLRVK |
? | GO:0004888 ... | P20963 | 38657677 | |
36302 | 8jcb:m (9.5) |
BS01 | >8jcb:b (identical to 8jc0:b, 8jcb:B, 8wxe:b, 8wyi:b)LDPKLCYLLDGILFIYGVILTALFLRVK |
? | GO:0002250 ... | A0A1B0GX56 B7Z8K6 |
38657677 | |
36303 | 8jd6:B (3.4) |
BS01 | >8jd6:C (identical to 7e9h:C)KVSKAAADLMAYCEAHAKE |
? | GO:0001750 ... | P62873 | 37286794 | |
36304 | 8je1:A (3.95) |
BS01 | >8je1:RKKWNAVALWAWD |
? | GO:0000082 ... | Q13617 | 38360992 | |
36305 | 8je2:D (3.63) |
BS01 | >8je2:HLFKESEEIRTPNCNCKYCSHPLL |
? | GO:0002070 ... | Q9UK73 | 38360992 | |
36306 | 8jfi:C (2.38) |
BS01 | >8jfi:ILDVVELIMA |
N/A | GO:0004316 ... | N/A | 37779101 | |
36307 | 8jfi:D (2.38) |
BS01 | >8jfi:HLDVVELIMAIVNVGD |
N/A | GO:0004316 ... | N/A | 37779101 | |
36308 | 8jfi:E (2.38) |
BS01 | >8jfi:HLDVVELIMAIVNVGD |
N/A | GO:0004316 ... | N/A | 37779101 | |
36309 | 8jg4:A (2.3) |
BS01 | >8jg4:D (identical to 8i60:A, 8i60:B, 8jg4:C)ARKSAP |
? | N/A | Q9FH40 | N/A | |
36310 | 8jg4:B (2.3) |
BS01 | >8jg4:C (identical to 8i60:A, 8i60:B, 8jg4:D)ARKSAP |
? | N/A | Q9FH40 | N/A | |
36311 | 8jgf:R (2.7) |
BS01 | >8jgf:LRPEWWMDYQKRY |
? | GO:0004888 ... | Q96LB2 | 37591889 | |
36312 | 8jgg:R (3.0) |
BS01 | >8jgg:L (identical to 8dwc:A)PEWWMDYQKRY |
? | GO:0004888 ... | Q96LB2 | 37591889 | |
36313 | 8jhv:A (3.47) |
BS01 | >8jhv:C (identical to 8jhv:F, 8jhw:C)VTFEKSYNTV |
? | N/A | P01901 | N/A | |
36314 | 8jhv:D (3.47) |
BS01 | >8jhv:F (identical to 8jhv:C, 8jhw:C)VTFEKSYNTV |
? | N/A | P01901 | N/A | |
36315 | 8jhw:A (3.12) |
BS01 | >8jhw:C (identical to 8jhv:C, 8jhv:F)VTFEKSYNTV |
? | N/A | P01901 | N/A | |
36316 | 8jip:R (2.85) |
BS01 | >8jip:PHSQGTFTSDKSEYLDSERAQDFVAWLEAG |
? | GO:0004888 ... | P43220 | 37549266 | |
36317 | 8jiq:R (3.4) |
BS01 | >8jiq:E (identical to 8jis:P, 6whc:E)HSQGTFTSDYSKYLDEQAAKEFIAWLMNT |
? | GO:0004888 ... | P47871 | 37549266 | |
36318 | 8jir:R (2.57) |
BS01 | >8jir:P (identical to 8jiu:P)HSQGTFTSDLSKQKESKAAQDFIEWLKAG |
? | GO:0004888 ... | P43220 | 37549266 | |
36319 | 8jis:R (2.46) |
BS01 | >8jis:P (identical to 8jiq:E, 6whc:E)HSQGTFTSDYSKYLDEQAAKEFIAWLMNT |
? | GO:0004888 ... | P43220 | 37549266 | |
36320 | 8jit:R (2.91) |
BS01 | >8jit:PHSQGTFTSDKSEYLDSERARDFVAWLEAG |
? | GO:0004888 ... | P47871 | 37549266 | |
36321 | 8jiu:R (2.76) |
BS01 | >8jiu:P (identical to 8jir:P)HSQGTFTSDLSKQKESKAAQDFIEWLKAG |
? | GO:0004888 ... | P47871 | 37549266 | |
36322 | 8jj9:A (2.51) |
BS01 | >8jj9:CRHVSSSDRVGKPYRGVKPVFS |
? | N/A | Q658Y4 | 37903274 | |
36323 | 8jj9:B (2.51) |
BS01 | >8jj9:DRHVSSSDRVGKPYRGVKPVF |
? | N/A | Q658Y4 | 37903274 | |
36324 | 8jjp:A (2.9) |
BS01 | >8jjp:L (identical to 8sg1:L, 7ykd:L)YFPGQFAFS |
N/A | N/A | P46091 | N/A | |
36325 | 8jjs:A (1.534) |
BS01 | >8jjs:IAIGGFGPLFLD |
3.6.5.2 | GO:0000139 ... | P01116 | 37463267 | |
36326 | 8jjv:A (1.23) |
BS01 | >8jjv:BEGVVHGVATVA |
N/A | N/A | N/A | 38105512 | |
36327 | 8jly:A (1.29) |
BS01 | >8jly:BGVVHGVATVA |
N/A | N/A | N/A | 38105512 | |
36328 | 8jmj:A (2.57) |
BS03 | >8jmj:M (identical to 8jmj:L, 8jmj:K)MAKNKVLGRG |
? | GO:0005524 ... | O25759 | 38842933 | |
36329 | 8jmj:B (2.57) |
BS03 | >8jmj:NKNKVLGRG |
? | GO:0005524 ... | O25759 | 38842933 | |
36330 | 8jmj:C (2.57) |
BS03 | >8jmj:K (identical to 8jmj:L, 8jmj:M)MAKNKVLGRG |
? | GO:0005524 ... | O25759 | 38842933 | |
36331 | 8jmj:D (2.57) |
BS02 | >8jmj:L (identical to 8jmj:K, 8jmj:M)MAKNKVLGRG |
? | GO:0005524 ... | O25759 | 38842933 | |
36332 | 8joq:A (1.796) |
BS01 | >8joq:BPISSTPL |
2.7.11.21 | N/A | P53350 | 37684534 | |
36333 | 8jow:A (1.4) |
BS01 | >8jow:BRPHFPQFSYSAS |
N/A | N/A | N/A | N/A | |
36334 | 8jow:C (1.4) |
BS01 | >8jow:DRPHFPQFSYSA |
N/A | N/A | N/A | N/A | |
36335 | 8joy:A (2.61) |
BS01 | >8joy:BPKTSTPR |
2.7.11.21 | N/A | P53350 | 37684534 | |
36336 | 8jpb:R (3.07) |
BS01 | >8jpb:L (identical to 4buo:C, 4buo:D, 8fmz:F, 8fn0:F, 8fn1:F, 4grv:B, 8jpc:L, 8jpf:L, 7l0p:D, 7l0q:D, 7l0r:D, 7l0s:D, 4po7:P, 5t04:B, 6up7:C, 4xee:B, 4xes:B)RRPYIL |
? | GO:0001659 ... | P30989 | 37532940 | |
36337 | 8jpc:R (3.07) |
BS01 | >8jpc:L (identical to 4buo:C, 4buo:D, 8fmz:F, 8fn0:F, 8fn1:F, 4grv:B, 8jpb:L, 8jpf:L, 7l0p:D, 7l0q:D, 7l0r:D, 7l0s:D, 4po7:P, 5t04:B, 6up7:C, 4xee:B, 4xes:B)RRPYIL |
? | GO:0001659 ... | P30989 | 37532940 | |
36338 | 8jpf:R (3.02) |
BS01 | >8jpf:L (identical to 4buo:C, 4buo:D, 8fmz:F, 8fn0:F, 8fn1:F, 4grv:B, 8jpb:L, 8jpc:L, 7l0p:D, 7l0q:D, 7l0r:D, 7l0s:D, 4po7:P, 5t04:B, 6up7:C, 4xee:B, 4xes:B)RRPYIL |
? | GO:0001659 ... | P30989 | 37532940 | |
36339 | 8jqt:A (1.99) |
BS01 | >8jqt:CGPAKGIEYD |
N/A | N/A | Q6JWQ7 | N/A | |
36340 | 8jr4:A (2.3) |
BS01 | >8jr4:ESFIIRSMPEQTSS |
N/A | N/A | N/A | N/A | |
36341 | 8jr4:B (2.3) |
BS01 | >8jr4:ESFIIRSMPEQTSS |
N/A | N/A | N/A | N/A | |
36342 | 8jrj:A (2.5) |
BS01 | >8jrj:EASFIIRSMPQET |
N/A | N/A | N/A | N/A | |
36343 | 8jrj:B (2.5) |
BS01 | >8jrj:EASFIIRSMPQET |
N/A | N/A | N/A | N/A | |
36344 | 8jrk:A (2.3) |
BS01 | >8jrk:ENDILSRLDPPEA |
N/A | N/A | N/A | N/A | |
36345 | 8jrk:B (2.3) |
BS01 | >8jrk:ENDILSRLDPPEA |
N/A | N/A | N/A | N/A | |
36346 | 8jrk:C (2.3) |
BS01 | >8jrk:FNDILSRLDPPEAS |
N/A | N/A | N/A | N/A | |
36347 | 8jrk:D (2.3) |
BS01 | >8jrk:FNDILSRLDPPEAS |
N/A | N/A | N/A | N/A | |
36348 | 8jrv:R (3.3) |
BS01 | >8jrv:GHSQGTFTSDYSKYLDSRRAQDFVQW |
? 3.4.21.69 |
GO:0004888 ... | P03435 P04070 P30518 P47871 |
37558880 | |
36349 | 8jt1:A (2.0) |
BS01 | >8jt1:C (identical to 5eiv:I, 5eiv:K, 8jt1:E, 8jt1:G, 8jt1:I, 7xeb:E, 7xeb:F, 7xeb:I, 7xeb:J)GPPGPP |
3.4.24.3 | GO:0004222 ... | F7IZI6 | 37698340 | |
36350 | 8jt1:A (2.0) |
BS02 | >8jt1:E (identical to 5eiv:I, 5eiv:K, 8jt1:C, 8jt1:G, 8jt1:I, 7xeb:E, 7xeb:F, 7xeb:I, 7xeb:J)GPPGPP |
3.4.24.3 | GO:0004222 ... | F7IZI6 | 37698340 | |
36351 | 8jt1:A (2.0) |
BS03 | >8jt1:F (identical to 8jt1:J, 7xeb:C, 7xeb:D, 7xeb:G, 7xeb:H)GPP |
3.4.24.3 | GO:0004222 ... | F7IZI6 | 37698340 | |
36352 | 8jt1:B (2.0) |
BS01 | >8jt1:G (identical to 5eiv:I, 5eiv:K, 8jt1:C, 8jt1:E, 8jt1:I, 7xeb:E, 7xeb:F, 7xeb:I, 7xeb:J)GPPGPP |
3.4.24.3 | GO:0004222 ... | F7IZI6 | 37698340 | |
36353 | 8jt1:B (2.0) |
BS02 | >8jt1:I (identical to 5eiv:I, 5eiv:K, 8jt1:C, 8jt1:E, 8jt1:G, 7xeb:E, 7xeb:F, 7xeb:I, 7xeb:J)GPPGPP |
3.4.24.3 | GO:0004222 ... | F7IZI6 | 37698340 | |
36354 | 8jt1:B (2.0) |
BS03 | >8jt1:J (identical to 8jt1:F, 7xeb:C, 7xeb:D, 7xeb:G, 7xeb:H)GPP |
3.4.24.3 | GO:0004222 ... | F7IZI6 | 37698340 | |
36355 | 8jud:A (1.5) |
BS01 | >8jud:B (identical to 7wxx:B)EGLV |
3.4.24.23 | GO:0004222 ... | P09237 | 37861435 | |
36356 | 8juf:A (1.39) |
BS01 | >8juf:B (identical to 8jug:C)EGFV |
3.4.24.23 | GO:0004222 ... | P09237 | 37861435 | |
36357 | 8jug:A (1.3) |
BS01 | >8jug:C (identical to 8juf:B)EGFV |
3.4.24.23 | GO:0004222 ... | P09237 | 37861435 | |
36358 | 8jut:A (4.2) |
BS01 | >8jut:G (identical to 4cic:Q, 3drh:B, 6e11:0, 4iox:D, 7jr9:G, 7jrj:L, 8jut:N, 8juu:M, 8jxb:Q, 8jxh:Q, 8jxi:G, 3naz:F, 6nir:X, 4nz8:C, 7od6:F, 7od6:E, 7od8:E, 7od8:F, 7oen:F, 7oev:E, 7oev:F, 7oew:E, 7oew:F, 3pv3:E, 3pv3:G, 8px3:F, 8px3:E, 6r19:F, 8sw1:B, 8sxf:D, 8sxg:D, 5tx1:Z, 5una:O, 3wa0:K, 5wql:F, 5wql:H, 2yjv:M, 4ynn:J, 4ynn:L, 6z7n:Y)AAAAAA |
N/A | N/A | P98158 | 38771880 | |
36359 | 8jut:A (4.2) |
BS02 | >8jut:H (identical to 8jut:O, 8juu:N, 8juu:Q, 8jxb:R, 8jxc:H, 8jxh:R, 8jxi:H)ANAAA |
N/A | N/A | P98158 | 38771880 | |
36360 | 8jut:A (4.2) |
BS03 | >8jut:I (identical to 8jut:P, 8juu:C, 8juu:I, 8jx8:C, 8jx8:I, 8jxe:I, 8jxe:C, 6tj1:D)AALAAA |
N/A | N/A | P98158 | 38771880 | |
36361 | 8jut:A (4.2) |
BS04 | >8jut:K (identical to 8jut:R, 8juu:G, 8juu:K, 8jx8:G, 8jx8:K, 8jxe:K, 8jxe:G)AEEAA |
N/A | N/A | P98158 | 38771880 | |
36362 | 8jut:A (4.2) |
BS05 | >8jut:L (identical to 8jut:M, 8jut:S, 8jut:T, 8juu:H, 8juu:L, 8juu:O, 8juu:R, 8jx8:H, 8jx8:L, 8jx9:O, 8jxa:M, 8jxe:L, 8jxe:H, 8jxf:O, 8jxg:M)AANAA |
N/A | N/A | P98158 | 38771880 | |
36363 | 8jut:A (4.2) |
BS06 | >8jut:M (identical to 8jut:L, 8jut:S, 8jut:T, 8juu:H, 8juu:L, 8juu:O, 8juu:R, 8jx8:H, 8jx8:L, 8jx9:O, 8jxa:M, 8jxe:L, 8jxe:H, 8jxf:O, 8jxg:M)AANAA |
N/A | N/A | P98158 | 38771880 | |
36364 | 8jut:B (4.2) |
BS01 | >8jut:N (identical to 4cic:Q, 3drh:B, 6e11:0, 4iox:D, 7jr9:G, 7jrj:L, 8jut:G, 8juu:M, 8jxb:Q, 8jxh:Q, 8jxi:G, 3naz:F, 6nir:X, 4nz8:C, 7od6:F, 7od6:E, 7od8:E, 7od8:F, 7oen:F, 7oev:E, 7oev:F, 7oew:E, 7oew:F, 3pv3:E, 3pv3:G, 8px3:F, 8px3:E, 6r19:F, 8sw1:B, 8sxf:D, 8sxg:D, 5tx1:Z, 5una:O, 3wa0:K, 5wql:F, 5wql:H, 2yjv:M, 4ynn:J, 4ynn:L, 6z7n:Y)AAAAAA |
N/A | N/A | P98158 | 38771880 | |
36365 | 8jut:B (4.2) |
BS02 | >8jut:O (identical to 8jut:H, 8juu:N, 8juu:Q, 8jxb:R, 8jxc:H, 8jxh:R, 8jxi:H)ANAAA |
N/A | N/A | P98158 | 38771880 | |
36366 | 8jut:B (4.2) |
BS03 | >8jut:P (identical to 8jut:I, 8juu:C, 8juu:I, 8jx8:C, 8jx8:I, 8jxe:I, 8jxe:C, 6tj1:D)AALAAA |
N/A | N/A | P98158 | 38771880 | |
36367 | 8jut:B (4.2) |
BS04 | >8jut:Q (identical to 8juu:D, 8juu:J, 8jx8:D, 8jxe:D)ACA |
N/A | N/A | P98158 | 38771880 | |
36368 | 8jut:B (4.2) |
BS05 | >8jut:R (identical to 8jut:K, 8juu:G, 8juu:K, 8jx8:G, 8jx8:K, 8jxe:K, 8jxe:G)AEEAA |
N/A | N/A | P98158 | 38771880 | |
36369 | 8jut:B (4.2) |
BS06 | >8jut:S (identical to 8jut:L, 8jut:M, 8jut:T, 8juu:H, 8juu:L, 8juu:O, 8juu:R, 8jx8:H, 8jx8:L, 8jx9:O, 8jxa:M, 8jxe:L, 8jxe:H, 8jxf:O, 8jxg:M)AANAA |
N/A | N/A | P98158 | 38771880 | |
36370 | 8jut:B (4.2) |
BS07 | >8jut:T (identical to 8jut:L, 8jut:M, 8jut:S, 8juu:H, 8juu:L, 8juu:O, 8juu:R, 8jx8:H, 8jx8:L, 8jx9:O, 8jxa:M, 8jxe:L, 8jxe:H, 8jxf:O, 8jxg:M)AANAA |
N/A | N/A | P98158 | 38771880 | |
36371 | 8juu:A (3.8) |
BS01 | >8juu:I (identical to 8jut:I, 8jut:P, 8juu:C, 8jx8:C, 8jx8:I, 8jxe:I, 8jxe:C, 6tj1:D)AALAAA |
N/A | N/A | P98158 | 38771880 | |
36372 | 8juu:A (3.8) |
BS02 | >8juu:J (identical to 8jut:Q, 8juu:D, 8jx8:D, 8jxe:D)ACA |
N/A | N/A | P98158 | 38771880 | |
36373 | 8juu:A (3.8) |
BS03 | >8juu:K (identical to 8jut:K, 8jut:R, 8juu:G, 8jx8:G, 8jx8:K, 8jxe:K, 8jxe:G)AEEAA |
N/A | N/A | P98158 | 38771880 | |
36374 | 8juu:A (3.8) |
BS04 | >8juu:L (identical to 8jut:L, 8jut:M, 8jut:S, 8jut:T, 8juu:H, 8juu:O, 8juu:R, 8jx8:H, 8jx8:L, 8jx9:O, 8jxa:M, 8jxe:L, 8jxe:H, 8jxf:O, 8jxg:M)AANAA |
N/A | N/A | P98158 | 38771880 | |
36375 | 8juu:A (3.8) |
BS05 | >8juu:M (identical to 4cic:Q, 3drh:B, 6e11:0, 4iox:D, 7jr9:G, 7jrj:L, 8jut:G, 8jut:N, 8jxb:Q, 8jxh:Q, 8jxi:G, 3naz:F, 6nir:X, 4nz8:C, 7od6:F, 7od6:E, 7od8:E, 7od8:F, 7oen:F, 7oev:E, 7oev:F, 7oew:E, 7oew:F, 3pv3:E, 3pv3:G, 8px3:F, 8px3:E, 6r19:F, 8sw1:B, 8sxf:D, 8sxg:D, 5tx1:Z, 5una:O, 3wa0:K, 5wql:F, 5wql:H, 2yjv:M, 4ynn:J, 4ynn:L, 6z7n:Y)AAAAAA |
N/A | N/A | P98158 | 38771880 | |
36376 | 8juu:A (3.8) |
BS06 | >8juu:N (identical to 8jut:H, 8jut:O, 8juu:Q, 8jxb:R, 8jxc:H, 8jxh:R, 8jxi:H)ANAAA |
N/A | N/A | P98158 | 38771880 | |
36377 | 8juu:A (3.8) |
BS07 | >8juu:O (identical to 8jut:L, 8jut:M, 8jut:S, 8jut:T, 8juu:H, 8juu:L, 8juu:R, 8jx8:H, 8jx8:L, 8jx9:O, 8jxa:M, 8jxe:L, 8jxe:H, 8jxf:O, 8jxg:M)AANAA |
N/A | N/A | P98158 | 38771880 | |
36378 | 8juu:B (3.8) |
BS01 | >8juu:C (identical to 8jut:I, 8jut:P, 8juu:I, 8jx8:C, 8jx8:I, 8jxe:I, 8jxe:C, 6tj1:D)AALAAA |
N/A | N/A | P98158 | 38771880 | |
36379 | 8juu:B (3.8) |
BS02 | >8juu:D (identical to 8jut:Q, 8juu:J, 8jx8:D, 8jxe:D)ACA |
N/A | N/A | P98158 | 38771880 | |
36380 | 8juu:B (3.8) |
BS03 | >8juu:G (identical to 8jut:K, 8jut:R, 8juu:K, 8jx8:G, 8jx8:K, 8jxe:K, 8jxe:G)AEEAA |
N/A | N/A | P98158 | 38771880 | |
36381 | 8juu:B (3.8) |
BS04 | >8juu:H (identical to 8jut:L, 8jut:M, 8jut:S, 8jut:T, 8juu:L, 8juu:O, 8juu:R, 8jx8:H, 8jx8:L, 8jx9:O, 8jxa:M, 8jxe:L, 8jxe:H, 8jxf:O, 8jxg:M)AANAA |
N/A | N/A | P98158 | 38771880 | |
36382 | 8juu:B (3.8) |
BS05 | >8juu:Q (identical to 8jut:H, 8jut:O, 8juu:N, 8jxb:R, 8jxc:H, 8jxh:R, 8jxi:H)ANAAA |
N/A | N/A | P98158 | 38771880 | |
36383 | 8juu:B (3.8) |
BS06 | >8juu:R (identical to 8jut:L, 8jut:M, 8jut:S, 8jut:T, 8juu:H, 8juu:L, 8juu:O, 8jx8:H, 8jx8:L, 8jx9:O, 8jxa:M, 8jxe:L, 8jxe:H, 8jxf:O, 8jxg:M)AANAA |
N/A | N/A | P98158 | 38771880 | |
36384 | 8jv0:A (2.2) |
BS01 | >8jv0:C (identical to 8jv0:F)YMNCSLPTY |
? | N/A | B1A9P1 | N/A | |
36385 | 8jv0:D (2.2) |
BS01 | >8jv0:F (identical to 8jv0:C)YMNCSLPTY |
? | N/A | B1A9P1 | N/A | |
36386 | 8jww:A (3.5) |
BS01 | >8jww:F (identical to 8ixl:F, 8ixl:L, 8ixl:S, 8ixl:BA, 8ixl:IA, 8jww:L, 8jww:S, 8jww:BA, 8jww:IA)ADFDTIYQAMIQISVVLCFALGIIAGGQR |
? | GO:0016020 ... | P69541 | N/A | |
36387 | 8jww:D (3.5) |
BS01 | >8jww:F (identical to 8ixl:F, 8ixl:L, 8ixl:S, 8ixl:BA, 8ixl:IA, 8jww:L, 8jww:S, 8jww:BA, 8jww:IA)ADFDTIYQAMIQISVVLCFALGIIAGGQR |
? | GO:0016020 ... | P69538 | N/A | |
36388 | 8jww:D (3.5) |
BS02 | >8jww:IA (identical to 8ixl:F, 8ixl:L, 8ixl:S, 8ixl:BA, 8ixl:IA, 8jww:F, 8jww:L, 8jww:S, 8jww:BA)ADFDTIYQAMIQISVVLCFALGIIAGGQR |
? | GO:0016020 ... | P69538 | N/A | |
36389 | 8jww:DA (3.5) |
BS01 | >8jww:BA (identical to 8ixl:F, 8ixl:L, 8ixl:S, 8ixl:BA, 8ixl:IA, 8jww:F, 8jww:L, 8jww:S, 8jww:IA)ADFDTIYQAMIQISVVLCFALGIIAGGQR |
? | GO:0016020 ... | P69541 | N/A | |
36390 | 8jww:GA (3.5) |
BS01 | >8jww:BA (identical to 8ixl:F, 8ixl:L, 8ixl:S, 8ixl:BA, 8ixl:IA, 8jww:F, 8jww:L, 8jww:S, 8jww:IA)ADFDTIYQAMIQISVVLCFALGIIAGGQR |
? | GO:0016020 ... | P69538 | N/A | |
36391 | 8jww:GA (3.5) |
BS02 | >8jww:IA (identical to 8ixl:F, 8ixl:L, 8ixl:S, 8ixl:BA, 8ixl:IA, 8jww:F, 8jww:L, 8jww:S, 8jww:BA)ADFDTIYQAMIQISVVLCFALGIIAGGQR |
? | GO:0016020 ... | P69538 | N/A | |
36392 | 8jww:J (3.5) |
BS01 | >8jww:F (identical to 8ixl:F, 8ixl:L, 8ixl:S, 8ixl:BA, 8ixl:IA, 8jww:L, 8jww:S, 8jww:BA, 8jww:IA)ADFDTIYQAMIQISVVLCFALGIIAGGQR |
? | GO:0016020 ... | P69538 | N/A | |
36393 | 8jww:J (3.5) |
BS02 | >8jww:L (identical to 8ixl:F, 8ixl:L, 8ixl:S, 8ixl:BA, 8ixl:IA, 8jww:F, 8jww:S, 8jww:BA, 8jww:IA)ADFDTIYQAMIQISVVLCFALGIIAGGQR |
? | GO:0016020 ... | P69538 | N/A | |
36394 | 8jww:N (3.5) |
BS01 | >8jww:L (identical to 8ixl:F, 8ixl:L, 8ixl:S, 8ixl:BA, 8ixl:IA, 8jww:F, 8jww:S, 8jww:BA, 8jww:IA)ADFDTIYQAMIQISVVLCFALGIIAGGQR |
? | GO:0016020 ... | P69541 | N/A | |
36395 | 8jww:Q (3.5) |
BS01 | >8jww:L (identical to 8ixl:F, 8ixl:L, 8ixl:S, 8ixl:BA, 8ixl:IA, 8jww:F, 8jww:S, 8jww:BA, 8jww:IA)ADFDTIYQAMIQISVVLCFALGIIAGGQR |
? | GO:0016020 ... | P69538 | N/A | |
36396 | 8jww:Q (3.5) |
BS02 | >8jww:S (identical to 8ixl:F, 8ixl:L, 8ixl:S, 8ixl:BA, 8ixl:IA, 8jww:F, 8jww:L, 8jww:BA, 8jww:IA)ADFDTIYQAMIQISVVLCFALGIIAGGQR |
? | GO:0016020 ... | P69538 | N/A | |
36397 | 8jww:V (3.5) |
BS01 | >8jww:S (identical to 8ixl:F, 8ixl:L, 8ixl:S, 8ixl:BA, 8ixl:IA, 8jww:F, 8jww:L, 8jww:BA, 8jww:IA)ADFDTIYQAMIQISVVLCFALGIIAGGQR |
? | GO:0016020 ... | P69541 | N/A | |
36398 | 8jww:Y (3.5) |
BS01 | >8jww:S (identical to 8ixl:F, 8ixl:L, 8ixl:S, 8ixl:BA, 8ixl:IA, 8jww:F, 8jww:L, 8jww:BA, 8jww:IA)ADFDTIYQAMIQISVVLCFALGIIAGGQR |
? | GO:0016020 ... | P69538 | N/A | |
36399 | 8jww:Y (3.5) |
BS02 | >8jww:BA (identical to 8ixl:F, 8ixl:L, 8ixl:S, 8ixl:BA, 8ixl:IA, 8jww:F, 8jww:L, 8jww:S, 8jww:IA)ADFDTIYQAMIQISVVLCFALGIIAGGQR |
? | GO:0016020 ... | P69538 | N/A | |
36400 | 8jww:Z (3.5) |
BS01 | >8jww:IA (identical to 8ixl:F, 8ixl:L, 8ixl:S, 8ixl:BA, 8ixl:IA, 8jww:F, 8jww:L, 8jww:S, 8jww:BA)ADFDTIYQAMIQISVVLCFALGIIAGGQR |
? | GO:0016020 ... | P69541 | N/A |