Structure of PDB 7eqd Chain R

Receptor sequence
>7eqdR (length=45) Species: 269796 (Rhodospirillum rubrum ATCC 11170) [Search protein sequence]
ITEGEAKEFHKIFTSSILVFFGVAAFAHLLVWIWRPWVPGPNGYS
3D structure
PDB7eqd Cryo-EM Structure of the Photosynthetic LH1-RC Complex from Rhodospirillum rubrum .
ChainR
Resolution2.76 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 07D R F31 V34 A35 A38 H39 V42 F20 V23 A24 A27 H28 V31
BS02 07D R F32 A35 H39 V42 W48 F21 A24 H28 V31 W37
BS03 CRT R E19 F20 I23 F24 S27 E8 F9 I12 F13 S16
Gene Ontology
Molecular Function
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0016020 membrane
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7eqd, PDBe:7eqd, PDBj:7eqd
PDBsum7eqd
PubMed34323477
UniProtQ2RQ23|LHB_RHORT Light-harvesting protein B-870 beta chain (Gene Name=Rru_A2977)

[Back to BioLiP]