Structure of PDB 7mq8 Chain NT

Receptor sequence

>7mq8NT (length=58) Species: 9606 (Homo sapiens)

KHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYC
GKCCLTYC

3D structure

• PDB: 7mq8 Nucleolar maturation of the human small subunit processome.
• Chain: NT
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	NT	K96 K99 L100 K104 Y105 R138 Y140 G142 K143 C145	K5 K8 L9 K13 Y14 R47 Y49 G51 K52 C54
BS02	ZN	NT	C121 C126 C144	C30 C35 C53

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 08:42:41 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7mq8', asym_id = 'NT', title = 'Nucleolar maturation of the human small subunit processome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7mq8', asym_id='NT', title='Nucleolar maturation of the human small subunit processome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7mq8', asym_id = 'NT'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7mq8', asym_id='NT')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>