Structure of PDB 5dat Chain M1
Receptor sequence
| >5datM1 (length=169) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
| QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT KEDTVSWFKQKYDADVLDK |
3D structure
| PDB | 5dat Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome | ||
| Chain | M1 | ||
| Resolution | 3.15 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | rna | M1 | N20 S22 G24 S48 A50 R51 Y52 V54 F57 I59 I65 H68 R94 N95 S97 A98 T99 N101 G103 F104 G105 D107 G124 M125 D126 Y128 R140 K142 | N15 S17 G19 S43 A45 R46 Y47 V49 F52 I54 I60 H63 R89 N90 S92 A93 T94 N96 G98 F99 G100 D102 G119 M120 D121 Y123 R135 K137 | |
| BS02 | rna | M1 | P8 M9 Q43 T44 V46 V69 T70 R72 G135 R137 R140 R141 K142 R143 V148 G149 N150 H152 | P3 M4 Q38 T39 V41 V64 T65 R67 G130 R132 R135 R136 K137 R138 V143 G144 N145 H147 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0003723 | RNA binding |
| GO:0003735 | structural constituent of ribosome |
| GO:0019843 | rRNA binding |
