Structure of PDB 8fkt Chain LB
Receptor sequence
| >8fktLB (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] |
| GVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRL FMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVC ALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRH F |
3D structure
| PDB | 8fkt Principles of human pre-60 S biogenesis. | ||
| Chain | LB | ||
| Resolution | 2.81 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | rna | LB | G2 H7 N8 R11 K12 V13 R14 R15 S20 F34 R37 R38 N40 T42 F43 M53 S54 R55 T56 R65 R68 L72 P73 R75 K78 T85 T87 D88 D89 V90 R91 R104 T106 S107 C134 G135 T136 L138 S140 R143 K144 G145 R146 E147 F152 | G1 H6 N7 R10 K11 V12 R13 R14 S19 F33 R36 R37 N39 T41 F42 M52 S53 R54 T55 R64 R67 L71 P72 R74 K77 T84 T86 D87 D88 V89 R90 R103 T105 S106 C133 G134 T135 L137 S139 R142 K143 G144 R145 E146 F151 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0003723 | RNA binding |
| GO:0003735 | structural constituent of ribosome |
| GO:0005515 | protein binding |
