Structure of PDB 3zke Chain I

Receptor sequence
>3zkeI (length=85) Species: 9606 (Homo sapiens) [Search protein sequence]
KAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTW
HCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
3D structure
PDB3zke Structural Analysis of the Regulation of the Dynll/Lc8 Binding to Nek9 by Phosphorylation
ChainI
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide I R60 N61 F62 G63 S64 Y65 V66 T67 H68 E69 T70 F73 Y75 Y77 R56 N57 F58 G59 S60 Y61 V62 T63 H64 E65 T66 F69 Y71 Y73
BS02 peptide I E35 K36 E31 K32
Gene Ontology
Molecular Function
GO:0004857 enzyme inhibitor activity
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0030235 nitric-oxide synthase regulator activity
GO:0036487 nitric-oxide synthase inhibitor activity
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
GO:0045505 dynein intermediate chain binding
GO:0060703 deoxyribonuclease inhibitor activity
GO:0097110 scaffold protein binding
Biological Process
GO:0006915 apoptotic process
GO:0006974 DNA damage response
GO:0007017 microtubule-based process
GO:0007286 spermatid development
GO:0021762 substantia nigra development
GO:0035721 intraciliary retrograde transport
GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0042326 negative regulation of phosphorylation
GO:0044458 motile cilium assembly
GO:0045019 negative regulation of nitric oxide biosynthetic process
GO:0110027 negative regulation of DNA strand resection involved in replication fork processing
Cellular Component
GO:0000776 kinetochore
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0008180 COP9 signalosome
GO:0015630 microtubule cytoskeleton
GO:0016020 membrane
GO:0030141 secretory granule
GO:0030286 dynein complex
GO:0035861 site of double-strand break
GO:0070821 tertiary granule membrane
GO:0072686 mitotic spindle
GO:0097542 ciliary tip
GO:0101003 ficolin-1-rich granule membrane
GO:1904115 axon cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3zke, PDBe:3zke, PDBj:3zke
PDBsum3zke
PubMed23482567
UniProtP63167|DYL1_HUMAN Dynein light chain 1, cytoplasmic (Gene Name=DYNLL1)

[Back to BioLiP]