Structure of PDB 5djq Chain F

Receptor sequence

>5djqF (length=303) Species: 316 (Stutzerimonas stutzeri)

MSTFWSGYIALLTLGTIVALFWLIFATRKGESAGTTDQTMGHAFDGIEEY
DNPLPRWWFLLFIGTLVFGILYLVLYPGLGNWKGVLPGYEGGWTQEKQWE
REVAQADEKYGPIFAKYAAMSVEEVAQDPQAVKMGARLFANYCSICHGSD
AKGSLGFPNLADQDWRWGGDAASIKTSILNGRIAAMPAWGQAIGEEGVKN
VAAFVRKDLAGLPLPEGTDADLSAGKNVYAQTCAVCHGQGGEGMAALGAP
KLNSAAGWIYGSSLGQLQQTIRHGRNGQMPAQQQYLGDDKVHLLAAYVYS
LSQ

3D structure

• PDB: 5djq The structure of cbb3 cytochrome oxidase provides insights into proton pumping.
• Chain: F
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	F	R166 A184 M186 P187 W189 T232 C233 C236 H237 G248 A249 P250 W258 I259 Y260 T270 I271 G277	R166 A184 M186 P187 W189 T232 C233 C236 H237 G248 A249 P250 W258 I259 Y260 T270 I271 G277
BS02	HEC	F	C143 C146 H147 P158 L160 W165 R166 W167 S177 I178 A184 G277 Q278 M279 P280 Q282	C143 C146 H147 P158 L160 W165 R166 W167 S177 I178 A184 G277 Q278 M279 P280 Q282
BS03	FC6	F	Q266 Q269	Q266 Q269
BS04	FC6	F	R206 P215 S263 L264	R206 P215 S263 L264

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006119 oxidative phosphorylation
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0070069 cytochrome complex

External links

• PDB: RCSB:5djq, PDBe:5djq, PDBj:5djq
• PDBsum: 5djq
• PubMed: 20576851
• UniProt: D9IA45|CCOP1_STUST Cbb3-type cytochrome c oxidase subunit CcoP1 (Gene Name=ccoP1)