Structure of PDB 8i9x Chain CK

Receptor sequence

>8i9xCK (length=238) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

PQNEYIERHRKLHGRRLDAEERARKKAAREGHKNSENAQNLRGLRAKLYA
KQRHAQKIQMRKAIKQHEERNVKGTAKALSSQIKNKRAEKAARFSVPIPK
VRGISEEEMFKVVKTGKKTHKKGWKRIVTKPTFVGPDFTRRPVKYERFIR
PMGLRYKKANVTHPTLNVTVQLPILSVKKNPSNPLYTQLGVLTKGTIIEV
NVSDLGIVTASGKIAWGRYAQITNNPENDGCVNAVLLV

3D structure

PDB

8i9x Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CK	P2 E5 Y6 I7 E8 K12 R23 R25 K26 A29 R30 H33 K34 S36 A39 Q40 R43 G44 L45 K48 L49 A51 K52 R54 H55 K58 I59 K100 S103 K107 K167 N183 N190 T192 Q194 S205 N206 D252 N256	P1 E4 Y5 I6 E7 K11 R22 R24 K25 A28 R29 H32 K33 S35 A38 Q39 R42 G43 L44 K47 L48 A50 K51 R53 H54 K57 I58 K77 S80 K84 K144 N160 N167 T169 Q171 S182 N183 D229 N233

Gene Ontology

	Biological Process
GO:0000460	maturation of 5.8S rRNA
GO:0000470	maturation of LSU-rRNA
GO:0006364	rRNA processing
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8i9x, PDBe:8i9x, PDBj:8i9x
PDBsum	8i9x
PubMed	37129998
UniProt	G0S081

[Back to BioLiP]