Structure of PDB 8evs Chain BM

Receptor sequence
>8evsBM (length=124) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AEVTIEDALKVVLRTALVHDGLARGLRESTKALTRGEALLVVLVSSVTEA
NIIKLVEGLANDPENKVPLIKVADAKQLGEWAGLGKIDREGNARKVVGAS
VVVVKNWGAETDELSMIMEHFSQQ
3D structure
PDB8evs Regulation of translation by ribosomal RNA pseudouridylation.
ChainBM
Resolution2.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 U BM R46 K50 R27 K31
BS02 G BM G44 L45 V66 G117 S119 G25 L26 V47 G98 S100
BS03 G BM G44 R46 G25 R27
BS04 U BM E47 K50 E28 K31
BS05 A BM R43 G104 K105 K114 R24 G85 K86 K95
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 21:32:49 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8evs', asym_id = 'BM', title = 'Regulation of translation by ribosomal RNA pseudouridylation.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8evs', asym_id='BM', title='Regulation of translation by ribosomal RNA pseudouridylation.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8evs', asym_id = 'BM'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8evs', asym_id='BM')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>