Structure of PDB 2hs2 Chain B |
>2hs2B (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKLIGGI GGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF |
|
PDB | 2hs2 Ultra-high Resolution Crystal Structure of HIV-1 Protease Mutant Reveals Two Binding Sites for Clinical Inhibitor TMC114. |
Chain | B |
Resolution | 1.22 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D125 T126 G127 |
Catalytic site (residue number reindexed from 1) |
D25 T26 G27 |
Enzyme Commision number |
3.4.23.16: HIV-1 retropepsin. |
|
|
|
|